KEGG   Medicago truncatula (barrel medic): MTR_5g030360Help
Entry
MTR_5g030360      CDS       T01716                                 

Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_5g030360
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MTR_5g030360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 715 aa AA seqDB search
MSDSNSPRGEQEQEQEENQMNSSSMMSSISETLDPAQMGISLADLEDDIDVDVDVVGVSE
PEDAGLTNADIFSVMSTGDVPQVDIGDLSDIWPGPMDLAVYAPVPINSTRILAAPPQAWL
PPDDENWIYDFNEEALQDEVYDSDSKAVPLMIGAGLANLGNTCFLNSIMQCFTHTVPLVE
GLLLSCHSPNDGHNGFCVICAFRYQMKQSLESTGRVISPVVFVDNLKQFSSDFRRHQQED
AHEFMQCALDKLETCFSNFEEDNIAKKVFGGSLVSKLRCCNCSRSSITNEQLIDLSLEIE
NVDSISSALESFTMVENIDAKLKCEGCNEEVSVEKQLMLDQTPSIAAFHLKRFKTVGNNA
VEKIDKHINFPLELDLQPYTILNESDNASLKYDLYAVVVHNGTSSDSGHYFCFVRTAPDT
WHKLDDSMVTKVSEGTVLSQEAYILFYARQGTPWFSSFAESTIPCLNLSRMNTSPKSVLD
ITDGQDKSFSISNENIERSGVGKSKKNSEKSDYSCQQSRKFPENDDVIDASPCRKQFPAG
PSNQKTLHLNGSEDISAQVLPVNYASPTGIAKPGGSSYAENVAPDKSKCSLEANDFIEND
VFNALTPPNSPPSQTPGKSFQISRDHLKKEKQGISGKRSSSGKSSDNPQNKAARAYVRNM
PGSRRGAFLDLLGDSPENKRKKTGSSHSDKDSSSARKKSGHASVGSYPVAAGVSQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcaaattcaccacgtggtgaacaagaacaagaacaagaagagaatcaaatg
aattcatcttcaatgatgagttcaatttctgaaaccctagatcctgctcaaatgggtatt
tctttggctgatcttgaggatgacattgacgttgacgttgatgttgtgggagtttctgag
cctgaggatgcggggttaaccaacgctgatattttttccgtaatgtccaccggtgatgtt
ccgcaggtagatattggtgatttgtcagatatttggccggggccgatggatcttgctgtg
tatgctccggttccgattaattctactcggattttggctgcgccgccccaagcttggtta
cctcctgatgatgagaactggatttatgattttaatgaagaagccttacaggatgaagtt
tatgattctgattctaaagctgtgccattgatgattggagctgggcttgccaaccttggt
aacacatgctttctcaattcaattatgcaatgcttcacgcataccgtgcccctagttgag
ggtcttcttttgagctgccattctcctaatgatggtcataatgggttctgtgttatctgt
gctttccgctatcagatgaaacagtccttggagtctactggaagagtcatctcccctgtg
gtatttgtggataatttgaagcaattttcttctgactttagaagacatcagcaagaggat
gcacatgagtttatgcagtgtgcattggataaacttgagacatgtttttcaaattttgag
gaggataatattgcgaagaaagtctttggaggcagtctggttagcaagcttcggtgttgt
aactgtagccgctcttccatcactaatgagcagttgattgacctgagtctagaaatagaa
aatgtagattctatttcaagtgcattggagtctttcacaatggtggaaaacattgatgct
aagcttaaatgtgagggctgcaatgaagaagtgtctgtggagaaacagcttatgttggat
cagacaccttcaattgctgcattccatttaaagaggtttaagacagttgggaataatgca
gttgaaaagattgacaagcatatcaattttccattggagttggatttgcaaccttacacc
attttgaatgaaagcgataatgcatcattgaaatatgatctatatgcagttgttgtgcat
aatggaacttcatctgactctgggcattatttctgctttgttcgcactgctccagacaca
tggcataagttggatgattcaatggtaactaaggtatctgaagggactgtgctgtctcag
gaagcatacatattgttttatgcccgacaaggcacaccttggttttcaagttttgcagaa
tctacaattccatgcttgaatctgagtaggatgaacacgtctcccaagtctgttttagac
atcactgatggccaagataaatcattttctatttcaaatgaaaatattgaaaggagtggg
gtcggtaaatccaaaaaaaattctgagaagtctgattattcttgtcaacaaagtcgcaag
tttcctgaaaatgacgatgttattgatgcttctccttgccgcaaacaatttcctgctggg
ccatcaaatcagaaaactcttcatttgaatggatcggaagatatcagcgcccaagtgcta
cctgtgaattatgccagcccgactggcattgcaaagcctggtgggagttcatatgctgag
aatgttgctcctgataaaagcaaatgcagtctggaagctaatgattttatagagaatgat
gttttcaatgccttaactcctcccaactctcccccttctcagactccaggtaagagtttc
cagatctcacgcgatcatttgaagaaagagaagcaaggaattagtggtaaaagatcatca
tcaggcaagtcttcggataatcctcaaaataaagctgccagggcatatgttaggaatatg
cctggttcaaggagaggtgcatttttggacttacttggcgattctccagaaaacaagaga
aaaaagactggttcatcgcattctgacaaagacagcagcagtgctcgcaagaaatcaggc
catgcttctgtcggaagctaccctgtggcagccggagtttcacagtga

DBGET integrated database retrieval system