KEGG   Medicago truncatula (barrel medic): MTR_5g030360Help
Entry
MTR_5g030360      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 715 aa AA seqDB search
MSDSNSPRGEQEQEQEENQMNSSSMMSSISETLDPAQMGISLADLEDDIDVDVDVVGVSE
PEDAGLTNADIFSVMSTGDVPQVDIGDLSDIWPGPMDLAVYAPVPINSTRILAAPPQAWL
PPDDENWIYDFNEEALQDEVYDSDSKAVPLMIGAGLANLGNTCFLNSIMQCFTHTVPLVE
GLLLSCHSPNDGHNGFCVICAFRYQMKQSLESTGRVISPVVFVDNLKQFSSDFRRHQQED
AHEFMQCALDKLETCFSNFEEDNIAKKVFGGSLVSKLRCCNCSRSSITNEQLIDLSLEIE
NVDSISSALESFTMVENIDAKLKCEGCNEEVSVEKQLMLDQTPSIAAFHLKRFKTVGNNA
VEKIDKHINFPLELDLQPYTILNESDNASLKYDLYAVVVHNGTSSDSGHYFCFVRTAPDT
WHKLDDSMVTKVSEGTVLSQEAYILFYARQGTPWFSSFAESTIPCLNLSRMNTSPKSVLD
ITDGQDKSFSISNENIERSGVGKSKKNSEKSDYSCQQSRKFPENDDVIDASPCRKQFPAG
PSNQKTLHLNGSEDISAQVLPVNYASPTGIAKPGGSSYAENVAPDKSKCSLEANDFIEND
VFNALTPPNSPPSQTPGKSFQISRDHLKKEKQGISGKRSSSGKSSDNPQNKAARAYVRNM
PGSRRGAFLDLLGDSPENKRKKTGSSHSDKDSSSARKKSGHASVGSYPVAAGVSQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcaaattcaccacgtggtgaacaagaacaagaacaagaagagaatcaaatg
aattcatcttcaatgatgagttcaatttctgaaaccctagatcctgctcaaatgggtatt
tctttggctgatcttgaggatgacattgacgttgacgttgatgttgtgggagtttctgag
cctgaggatgcggggttaaccaacgctgatattttttccgtaatgtccaccggtgatgtt
ccgcaggtagatattggtgatttgtcagatatttggccggggccgatggatcttgctgtg
tatgctccggttccgattaattctactcggattttggctgcgccgccccaagcttggtta
cctcctgatgatgagaactggatttatgattttaatgaagaagccttacaggatgaagtt
tatgattctgattctaaagctgtgccattgatgattggagctgggcttgccaaccttggt
aacacatgctttctcaattcaattatgcaatgcttcacgcataccgtgcccctagttgag
ggtcttcttttgagctgccattctcctaatgatggtcataatgggttctgtgttatctgt
gctttccgctatcagatgaaacagtccttggagtctactggaagagtcatctcccctgtg
gtatttgtggataatttgaagcaattttcttctgactttagaagacatcagcaagaggat
gcacatgagtttatgcagtgtgcattggataaacttgagacatgtttttcaaattttgag
gaggataatattgcgaagaaagtctttggaggcagtctggttagcaagcttcggtgttgt
aactgtagccgctcttccatcactaatgagcagttgattgacctgagtctagaaatagaa
aatgtagattctatttcaagtgcattggagtctttcacaatggtggaaaacattgatgct
aagcttaaatgtgagggctgcaatgaagaagtgtctgtggagaaacagcttatgttggat
cagacaccttcaattgctgcattccatttaaagaggtttaagacagttgggaataatgca
gttgaaaagattgacaagcatatcaattttccattggagttggatttgcaaccttacacc
attttgaatgaaagcgataatgcatcattgaaatatgatctatatgcagttgttgtgcat
aatggaacttcatctgactctgggcattatttctgctttgttcgcactgctccagacaca
tggcataagttggatgattcaatggtaactaaggtatctgaagggactgtgctgtctcag
gaagcatacatattgttttatgcccgacaaggcacaccttggttttcaagttttgcagaa
tctacaattccatgcttgaatctgagtaggatgaacacgtctcccaagtctgttttagac
atcactgatggccaagataaatcattttctatttcaaatgaaaatattgaaaggagtggg
gtcggtaaatccaaaaaaaattctgagaagtctgattattcttgtcaacaaagtcgcaag
tttcctgaaaatgacgatgttattgatgcttctccttgccgcaaacaatttcctgctggg
ccatcaaatcagaaaactcttcatttgaatggatcggaagatatcagcgcccaagtgcta
cctgtgaattatgccagcccgactggcattgcaaagcctggtgggagttcatatgctgag
aatgttgctcctgataaaagcaaatgcagtctggaagctaatgattttatagagaatgat
gttttcaatgccttaactcctcccaactctcccccttctcagactccaggtaagagtttc
cagatctcacgcgatcatttgaagaaagagaagcaaggaattagtggtaaaagatcatca
tcaggcaagtcttcggataatcctcaaaataaagctgccagggcatatgttaggaatatg
cctggttcaaggagaggtgcatttttggacttacttggcgattctccagaaaacaagaga
aaaaagactggttcatcgcattctgacaaagacagcagcagtgctcgcaagaaatcaggc
catgcttctgtcggaagctaccctgtggcagccggagtttcacagtga

DBGET integrated database retrieval system