KEGG   Medicago truncatula (barrel medic): MTR_5g032570Help
Entry
MTR_5g032570      CDS       T01716                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00030  Pentose phosphate pathway
mtr00051  Fructose and mannose metabolism
mtr00052  Galactose metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
mtr01230  Biosynthesis of amino acids
mtr03018  RNA degradation
Module
mtr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_5g032570
   00030 Pentose phosphate pathway
    MTR_5g032570
   00051 Fructose and mannose metabolism
    MTR_5g032570
   00052 Galactose metabolism
    MTR_5g032570
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MTR_5g032570
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MTR_5g032570
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MTR_5g032570
Messenger RNA biogenesis [BR:mtr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MTR_5g032570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 11405809
NCBI-ProteinID: XP_003613090
UniProt: G7JXR3
Position
5
AA seq 533 aa AA seqDB search
MNTHVITPNLNTTLLHHHHHHVHGLTNSSHRYSKTNHRLFHSFKVSNNVRVFSELKSQNK
IDYNDPDWKDKFKEDFEARFRLPHITDIFPDASSMRSTFCLKMRAPITRDFHGNYDSGEE
WNGYISDNDRVLLKTIYHSSPTSAGAQCIDPGCNWVEQWVHRAGPRKNIYFKPEEVKAAI
VTCGGLCPGLNDVIRQIVITLEIYGVTEIVGIPFGYRGFSDKELMEIPLSRKVVQNIHLS
GGSLLGVSRGGPGVSEIVDSLEERGINMLFVLGGNGTHAGANAIHDECCKRRIKVSVIGV
PKTIDNDILLMDKTFGFDTAVEEAQRAIYSAYIEAHSAYHGIGIVKLMGRSSGFIAMQSS
LASGQIDVCLIPEVPFDLHGPHGVLSHLKYLIESKGSAVVCVAEGAGQNLLQKTNDTDPS
GNAKLGDIGVYIQQETKNYFKENDIHADVKYIDPTYMIRACRANASDGILCTVLGQNAVH
GAFAGYSGITVGICNTHYAYFPITEVISHPQLVDPNSRMWHRCLTSTGQPDFI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcacgtgatcacccctaacctcaacaccacccttcttcatcatcatcatcat
catgtgcatggtttaacgaattcttcacaccgttactccaaaaccaaccatcgtctcttc
cattcattcaaagtctctaataacgttcgtgtcttttcagagctgaagagtcaaaacaaa
attgattacaatgatcctgattggaaagataagtttaaagaagattttgaggcacggttt
agactccctcatattactgatattttccctgatgcttcttctatgcgttctactttttgt
ctcaaaatgagggctcctataactagagactttcatgggaattatgattctggtgaggaa
tggaatggatacattagtgataatgacagagtgcttcttaagacaatataccattcatca
cctacatctgctggtgctcagtgcattgatcctggctgtaattgggtggaacaatgggtt
catcgagctggacctcggaaaaatatatacttcaaaccagaagaagtaaaggcagccatt
gttacttgtggaggactgtgtcctggtcttaacgatgtcattagacagattgtaatcaca
cttgaaatatatggtgtaacagagattgttggtattccttttggctatcgcggcttttct
gacaaagagttgatggaaataccgctgtcaaggaaagtcgttcaaaacattcatctctca
ggtggcagcctattaggagtttcacgcggaggacctggagttagtgaaattgtggatagt
ttggaggaaagagggatcaacatgctctttgtgttgggtggaaatggtacacatgctggt
gcaaatgcaattcacgacgagtgctgtaaaagacggattaaagtgtctgtaattggagtg
ccgaaaactatagacaatgatattctattgatggacaaaacttttggctttgacaccgcg
gttgaagaagcgcaaagagcaatatattctgcatatatagaggcgcatagtgcatatcat
ggaatcgggattgtgaaattaatgggtcgtagcagtggattcatagcaatgcaatcttcc
ttagccagtggacagattgatgtatgcctaattcctgaggttcctttcgatttacatgga
cctcatggagttttgagtcacctcaagtaccttatagaatcaaagggatcagctgtcgtt
tgtgtggcagagggagcaggacagaatttacttcaaaaaactaatgataccgatccctca
gggaatgctaaacttggagatatcggggtttatatccaacaagagacgaaaaattatttc
aaggagaatgatattcatgcagatgtgaaatatattgatccaacatacatgattcgggcg
tgtcgagcaaatgcatcagatggaattttatgcactgttcttggacaaaatgctgttcat
ggtgcatttgctggatatagtggcattacagtaggcatatgtaacacacattatgcttac
tttccaatcaccgaagtaatatcgcatcctcaattggtggatccgaacagtcgaatgtgg
catcgatgcttaacttcaactggtcaacccgacttcatttga

DBGET integrated database retrieval system