KEGG   Medicago truncatula (barrel medic): MTR_5g034240Help
Entry
MTR_5g034240      CDS       T01716                                 

Definition
STAM-binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MTR_5g034240
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MTR_5g034240
Peptidases [BR:mtr01002]
 Metallo Peptidases
  Family M67
   MTR_5g034240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 235 aa AA seqDB search
MECYKSFLDHKVTKSSPSPALCCVEPVTQDEQNSHITAFHSGDRSTNSDNESSSSKTVRD
VHISMRLMEDFLDLAKENTEKDLETCGILGAFLEKGTLYMTTLIIPKQESASNSCNATNE
EEVFTILNERSLYPVGWIHTHPSQSCFMSSVDLHTQYSYQAMIPEAFAIVLAPTDTSRSC
GLFRLTEPDGMNILRNCPERGFHPHKEPDNGNPVYEHCSNVYRNSNLRFEIFDLR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaatgctataaatcctttttagaccataaagtaaccaagtcctcgccttcccctgca
ctgtgttgtgtggagccagtgactcaagatgaacaaaattctcatattacagcttttcat
tcaggagatcgatccacaaattcagataatgaatcttcttcatcaaagaccgtgcgtgat
gtacatatctcaatgcggttaatggaggactttcttgatcttgctaaagaaaatacagaa
aaggatctggaaacatgtggtattcttggtgcctttcttgagaagggaaccctctatatg
accacactaatcataccgaagcaggaatccgcatctaattcatgtaatgccacaaatgag
gaggaagttttcacaattctaaatgaaagatccctttatcctgttggatggatccatacg
cacccttctcaaagttgtttcatgtcatcggtggatctgcacactcaatattcctaccag
gcgatgattcctgaggcatttgcgattgtgttggcaccaactgatacctcaaggagctgt
ggtctctttcgcctaaccgaaccagatggtatgaatattctaagaaattgtccggagagg
ggatttcatccacacaaagaaccagataatggcaaccctgtgtatgagcactgctccaat
gtgtacagaaactccaatttaaggtttgaaatctttgatttacgctaa

DBGET integrated database retrieval system