KEGG   Medicago truncatula (barrel medic): MTR_5g034240Help
Entry
MTR_5g034240      CDS       T01716                                 

Definition
STAM-binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mtr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 235 aa AA seqDB search
MECYKSFLDHKVTKSSPSPALCCVEPVTQDEQNSHITAFHSGDRSTNSDNESSSSKTVRD
VHISMRLMEDFLDLAKENTEKDLETCGILGAFLEKGTLYMTTLIIPKQESASNSCNATNE
EEVFTILNERSLYPVGWIHTHPSQSCFMSSVDLHTQYSYQAMIPEAFAIVLAPTDTSRSC
GLFRLTEPDGMNILRNCPERGFHPHKEPDNGNPVYEHCSNVYRNSNLRFEIFDLR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaatgctataaatcctttttagaccataaagtaaccaagtcctcgccttcccctgca
ctgtgttgtgtggagccagtgactcaagatgaacaaaattctcatattacagcttttcat
tcaggagatcgatccacaaattcagataatgaatcttcttcatcaaagaccgtgcgtgat
gtacatatctcaatgcggttaatggaggactttcttgatcttgctaaagaaaatacagaa
aaggatctggaaacatgtggtattcttggtgcctttcttgagaagggaaccctctatatg
accacactaatcataccgaagcaggaatccgcatctaattcatgtaatgccacaaatgag
gaggaagttttcacaattctaaatgaaagatccctttatcctgttggatggatccatacg
cacccttctcaaagttgtttcatgtcatcggtggatctgcacactcaatattcctaccag
gcgatgattcctgaggcatttgcgattgtgttggcaccaactgatacctcaaggagctgt
ggtctctttcgcctaaccgaaccagatggtatgaatattctaagaaattgtccggagagg
ggatttcatccacacaaagaaccagataatggcaaccctgtgtatgagcactgctccaat
gtgtacagaaactccaatttaaggtttgaaatctttgatttacgctaa

DBGET integrated database retrieval system