KEGG   Medicago truncatula (barrel medic): MTR_5g044980Help
Entry
MTR_5g044980      CDS       T01716                                 

Definition
Dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTR_5g044980
Enzymes [BR:mtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MTR_5g044980
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MTR_5g044980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 515 aa AA seqDB search
MSILKYLSARRSQLCAARNYLKVLGLSSLHTAPNSSVELHTQDEEVVIALGSNVGDRLQN
FKEALKLMRKSGINITRHASLYETAPAYVTDQPRFLNSAVRAVTKLGPHELLSALKRIEK
DMGRTDGIRYGPRPMDLDILFYGKFKVRSDILTVPHERIWERPFVMAPLMDLLGTAVDND
TVASWHSFSGHSGGLNALWEKLGGESLIGEEGMTRVMPVANGLLDWSQRTLVMGVLNLTP
DSFSDGGNFRSVESAVSQARLMISEGADIIDIGAQSTRPMASRISVEEELGRLIPVLEAV
MSIPEAEGKLISVDTFYSEVASEAVRRGAHLINDVSAGKLDSNMFKVMADLDVPYVAMHM
RGDPCTMQNNENLKYDNVCKDISSELYAQVKEAEMSGIPAWRIIMDPGIGFSKKTEDNLE
VLAGIPDIRAEFSKRSLAISHAPILIGPSRKRFLGEICSRTSAVERDPATIAAVTACVLG
GANIVRVHNVKDNLDAIKICDAIRRQKCCPVKFGQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacttaagtacctgagcgcgcgcaggagtcagctctgtgctgcaagaaactac
cttaaagtactcggattgtcatctcttcacacagctccaaactcctctgttgaacttcac
actcaagatgaggaagtagtgattgctttgggaagtaatgttggcgatagactacagaac
ttcaaggaagccttgaaattgatgagaaagtcaggcataaacattacaagacatgcgagt
ctgtatgagacagcaccagcgtatgttactgaccaacctcgcttcctgaactcagcagta
agagctgttactaaactcgggccacatgaattattgtctgcactgaaacgaatcgagaag
gacatgggccgtactgacggtataaggtatggtccaaggccaatggacttagacatttta
ttctatggtaaatttaaagtcagatctgatattctcacagtacctcatgaaagaatttgg
gaacgaccttttgtcatggcccctttgatggatttactgggaacagctgttgacaatgat
acagttgctagctggcattcattttcaggccattctggtggactaaatgcattatgggaa
aaattaggtggagaatcccttattggagaggaaggtatgactagggtaatgcctgttgca
aatggcttgcttgattggtcgcaaagaacattggtcatgggggttcttaatttgactcca
gatagttttagtgatgggggaaatttccggtctgtggaatctgctgtttcgcaggctcgg
ttgatgatatcagagggtgctgatataattgatatcggtgctcagtctactcggccgatg
gcatcgaggatctctgtcgaagaggaattaggtagattaatccctgtactggaagctgta
atgtcaatacctgaggcagaaggaaaactcatatcggtggatactttctactccgaagtt
gcatcagaggcagtgcgcagaggggctcatcttataaatgatgtatctgccgggaagtta
gattcaaatatgtttaaggtcatggcagaccttgatgttccttatgttgcaatgcacatg
aggggtgatccgtgtacaatgcagaataatgaaaacctgaaatatgataatgtctgcaag
gatatatcctcagaattatacgcgcaggttaaagaggcagaaatgtcgggaatcccggcg
tggaggattattatggaccctggaattggattctcaaagaaaactgaagacaatttagag
gtccttgcaggaatacctgatattagagcagagttttcaaaaagaagtttggcaatctct
catgctcctatactaattggaccttcaagaaagagatttttaggtgaaatttgctctcgc
acttctgcagttgagagggatcctgctaccattgctgctgttactgcctgtgtgttgggt
ggggctaatatcgttcgagtgcataatgtcaaagataatctagatgccattaagatttgt
gatgcaattcgaagacaaaaatgttgtccggtgaaatttggacagtga

DBGET integrated database retrieval system