KEGG   Medicago truncatula (barrel medic): MTR_5g044980Help
Entry
MTR_5g044980      CDS       T01716                                 

Definition
Dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 515 aa AA seqDB search
MSILKYLSARRSQLCAARNYLKVLGLSSLHTAPNSSVELHTQDEEVVIALGSNVGDRLQN
FKEALKLMRKSGINITRHASLYETAPAYVTDQPRFLNSAVRAVTKLGPHELLSALKRIEK
DMGRTDGIRYGPRPMDLDILFYGKFKVRSDILTVPHERIWERPFVMAPLMDLLGTAVDND
TVASWHSFSGHSGGLNALWEKLGGESLIGEEGMTRVMPVANGLLDWSQRTLVMGVLNLTP
DSFSDGGNFRSVESAVSQARLMISEGADIIDIGAQSTRPMASRISVEEELGRLIPVLEAV
MSIPEAEGKLISVDTFYSEVASEAVRRGAHLINDVSAGKLDSNMFKVMADLDVPYVAMHM
RGDPCTMQNNENLKYDNVCKDISSELYAQVKEAEMSGIPAWRIIMDPGIGFSKKTEDNLE
VLAGIPDIRAEFSKRSLAISHAPILIGPSRKRFLGEICSRTSAVERDPATIAAVTACVLG
GANIVRVHNVKDNLDAIKICDAIRRQKCCPVKFGQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacttaagtacctgagcgcgcgcaggagtcagctctgtgctgcaagaaactac
cttaaagtactcggattgtcatctcttcacacagctccaaactcctctgttgaacttcac
actcaagatgaggaagtagtgattgctttgggaagtaatgttggcgatagactacagaac
ttcaaggaagccttgaaattgatgagaaagtcaggcataaacattacaagacatgcgagt
ctgtatgagacagcaccagcgtatgttactgaccaacctcgcttcctgaactcagcagta
agagctgttactaaactcgggccacatgaattattgtctgcactgaaacgaatcgagaag
gacatgggccgtactgacggtataaggtatggtccaaggccaatggacttagacatttta
ttctatggtaaatttaaagtcagatctgatattctcacagtacctcatgaaagaatttgg
gaacgaccttttgtcatggcccctttgatggatttactgggaacagctgttgacaatgat
acagttgctagctggcattcattttcaggccattctggtggactaaatgcattatgggaa
aaattaggtggagaatcccttattggagaggaaggtatgactagggtaatgcctgttgca
aatggcttgcttgattggtcgcaaagaacattggtcatgggggttcttaatttgactcca
gatagttttagtgatgggggaaatttccggtctgtggaatctgctgtttcgcaggctcgg
ttgatgatatcagagggtgctgatataattgatatcggtgctcagtctactcggccgatg
gcatcgaggatctctgtcgaagaggaattaggtagattaatccctgtactggaagctgta
atgtcaatacctgaggcagaaggaaaactcatatcggtggatactttctactccgaagtt
gcatcagaggcagtgcgcagaggggctcatcttataaatgatgtatctgccgggaagtta
gattcaaatatgtttaaggtcatggcagaccttgatgttccttatgttgcaatgcacatg
aggggtgatccgtgtacaatgcagaataatgaaaacctgaaatatgataatgtctgcaag
gatatatcctcagaattatacgcgcaggttaaagaggcagaaatgtcgggaatcccggcg
tggaggattattatggaccctggaattggattctcaaagaaaactgaagacaatttagag
gtccttgcaggaatacctgatattagagcagagttttcaaaaagaagtttggcaatctct
catgctcctatactaattggaccttcaagaaagagatttttaggtgaaatttgctctcgc
acttctgcagttgagagggatcctgctaccattgctgctgttactgcctgtgtgttgggt
ggggctaatatcgttcgagtgcataatgtcaaagataatctagatgccattaagatttgt
gatgcaattcgaagacaaaaatgttgtccggtgaaatttggacagtga

DBGET integrated database retrieval system