KEGG   Medicago truncatula (barrel medic): MTR_5g059280Help
Entry
MTR_5g059280      CDS       T01716                                 

Definition
Serine/threonine protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MTR_5g059280
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: Other group
  TTK family
   MTR_5g059280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 732 aa AA seqDB search
MDGNPKSNPSHLPNPSSSELLRQFQVALKRRRNPGGALQSNIIRPKRSAVAEAKAMSKSE
DSQTSLDQSGNHSLKGSAVVAGEGFSDVKVCELENISSHLSSLALTEMDLASGVTEASTR
INQDMKYRTSQQAESEKSLISKGGKISMLPRRTLISQDHSDKFKNFLSQPATQSSIVGPS
CATTTSVHSSSAPMLNSLTGSSHSHPNSASNLVANRCGNLNPHQITHGVVNSVKETNITS
TDQATTGVQACSSLTDAELTFKERNSCKEQQGCALKETIISNNASCYDDALSKGKESAVA
TNTQPEAPTVSSDVKLESSKLGKPDKAASSKGPSGSRKRTYDPDYFFKVSGKLYQRLGRI
GSGGSSEVHKVISSDCTIYALKKIKLKGRDYATAYGFCQEIEYLNRLKGKSNIIQLIDYE
VTDKALLEGVLSGSFNNKDGRVKDDGFIYMVLEYGEIDLAHMLSQKWKELDGCNQTIDEN
WLRFYWQQILQAVNTIHEERIVHSDLKPANFLLVKGSLKLIDFGIAKAIMSDTTNIQRDS
QVGTLNYMSPEAFMCNESDANGNIIKCGRPSDIWSLGCILYQMVYGRTPFSDYKTFWAKV
KVITDPNHQITYEPVSNPCLVDLMKRCLAWDRNERWRIPQLLQHPFLAPPVSSHPSLSQD
HSFKWLQVIAETCKCDREAVQLCSQLQQVLGDPFSLITSDTSNSRDGQCKLLSRISEVCV
QLHERLTNSDNK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaaccctaaatctaacccttcgcatcttcctaacccttcctcttccgaactc
ctccgccaatttcaagtagctcttaaacgccgtcgaaaccccggtggtgcgttgcaatcg
aatattattcgaccaaagcgttctgctgttgctgaagcaaaggctatgagcaaatctgaa
gattctcaaacgagtttggatcaatctgggaatcattcgctaaagggtagtgctgttgtt
gctggagaggggttcagtgatgttaaggtctgtgagttggagaacatatcatctcacttg
agttcacttgcattgacagaaatggatttggcaagtggcgtaactgaagcatcaaccaga
atcaatcaagacatgaagtacagaactagtcaacaggcagagtctgaaaaaagcttgata
tctaagggaggaaaaatttctatgttgccaaggagaacgttaatttctcaagatcattca
gacaaattcaaaaactttttaagtcaaccagctacacaatcttctatagttggtccatct
tgtgcgacaactacatcagtccattcaagttcagctccaatgctgaattctctaactggt
tcttctcattcccatccaaatagtgcctcaaatttggttgcaaaccgttgtgggaacctc
aatcctcatcaaataactcacggggttgttaattcagtaaaagaaaccaatataacatca
actgatcaagcaactactggggtccaagcttgtagttcacttactgatgctgaattgacg
tttaaggagagaaactcatgtaaggagcagcaaggatgcgcattaaaggaaactatcatt
tcaaataatgcttcctgttatgatgatgcgttaagtaaaggaaaagagtctgcagttgct
accaacactcagcctgaggctccaactgtatcttcagatgtaaagttggagtcttcaaag
ttaggtaaaccagataaagctgccagttccaaaggaccatcaggttctcggaaaaggacc
tacgaccctgattatttttttaaagttagtggcaagctatatcaaaggcttggcagaata
ggaagtggtggaagtagtgaggtacacaaagtgatttcatccgactgtacaatctatgca
cttaaaaagataaagcttaagggtcgtgactatgccactgcatatggattttgtcaagag
attgaatatcttaacaggttgaaagggaaaagtaatatcatacaacttatagattatgag
gtgactgacaaggctttgcttgagggagtcttgagtggctccttcaacaataaggatggt
agagtgaaggatgatggatttatatacatggtacttgaatatggggaaattgatttggct
catatgttgtctcagaagtggaaggaactggatgggtgcaaccaaaccatagatgaaaac
tggcttcggttttactggcagcaaattcttcaagctgtcaacacaattcatgaggaacgt
attgtgcattctgacttgaagccagctaatttcctccttgtcaaaggttccctaaaattg
attgattttggtatagccaaagcaataatgagtgatacaacaaacatccagcgggattca
caggttggcactctaaattatatgtcaccagaggcatttatgtgcaatgagagtgatgcg
aatgggaacatcataaagtgtggtcggccatcagacatctggtctttaggatgcatcctt
tatcaaatggtatatgggagaacacctttttccgattacaagacattttgggccaaagtc
aaagtcataactgatccaaatcatcaaattacgtacgaaccggtttcaaatccatgtctt
gtggatctaatgaagagatgtcttgcatgggatcgcaatgaaaggtggagaattcctcag
ttactccagcatccttttcttgctcctccagtttcatctcatccttctttgtcccaagat
cattcctttaaatggctgcaagttattgccgaaacctgtaaatgtgaccgagaagcagtg
cagctttgtagtcagctccaacaggtgcttggtgaccccttttctttaataacttccgac
acttcaaattcacgagacggacagtgtaagttgctgtcccgcatatcagaagtctgtgtt
cagctgcatgaacgattaacgaattcggataataaataa

DBGET integrated database retrieval system