KEGG   Medicago truncatula (barrel medic): MTR_5g069880Help
Entry
MTR_5g069880      CDS       T01716                                 

Definition
Josephin-like protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_5g069880
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C86
   MTR_5g069880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 185 aa AA seqDB search
MSTEKSHVYHERQRLQFCLIHTLNSLFQQKDAFTRANLNAISEKLALDESFNNESSWTPL
SIFFKPHHNALTGNYDINVLTAALEEKGKSVVWHDRRKGGSSVDLDASEDVLMGVVINIA
VKRFAGIWKSRHWIALRKIDGVWYNLDSDLSAPKSFRDTDEVREFLDSSIVRGGEVLLVM
NQKQS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgagaaatcccatgtttatcacgaaagacaaagattacagttctgtctcata
cacactctcaactctctctttcagcaaaaagatgcttttactcgagcaaatttgaatgca
atttctgaaaaactagcacttgatgaatccttcaacaatgaatcatcatggacgccatta
tctatctttttcaagcctcatcataacgcattgaccggaaactatgacataaatgttcta
acagctgctttggaagagaaaggaaagagtgtagtttggcacgatcgacgaaagggagga
tcttcagttgatcttgatgcatcagaagatgttttgatgggggttgtgatcaatattgca
gtgaaaaggtttgctgggatttggaaaagtagacattggattgctttgaggaagattgat
ggtgtttggtataacttggatagtgacctttctgccccgaaaagttttcgtgatactgat
gaagtaagagagttcttggattctagcatagttcgtggtggtgaggttttgcttgtgatg
aatcagaaacagtcttga

DBGET integrated database retrieval system