KEGG   Medicago truncatula (barrel medic): MTR_5g069880Help
Entry
MTR_5g069880      CDS       T01716                                 

Definition
Josephin-like protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 185 aa AA seqDB search
MSTEKSHVYHERQRLQFCLIHTLNSLFQQKDAFTRANLNAISEKLALDESFNNESSWTPL
SIFFKPHHNALTGNYDINVLTAALEEKGKSVVWHDRRKGGSSVDLDASEDVLMGVVINIA
VKRFAGIWKSRHWIALRKIDGVWYNLDSDLSAPKSFRDTDEVREFLDSSIVRGGEVLLVM
NQKQS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgagaaatcccatgtttatcacgaaagacaaagattacagttctgtctcata
cacactctcaactctctctttcagcaaaaagatgcttttactcgagcaaatttgaatgca
atttctgaaaaactagcacttgatgaatccttcaacaatgaatcatcatggacgccatta
tctatctttttcaagcctcatcataacgcattgaccggaaactatgacataaatgttcta
acagctgctttggaagagaaaggaaagagtgtagtttggcacgatcgacgaaagggagga
tcttcagttgatcttgatgcatcagaagatgttttgatgggggttgtgatcaatattgca
gtgaaaaggtttgctgggatttggaaaagtagacattggattgctttgaggaagattgat
ggtgtttggtataacttggatagtgacctttctgccccgaaaagttttcgtgatactgat
gaagtaagagagttcttggattctagcatagttcgtggtggtgaggttttgcttgtgatg
aatcagaaacagtcttga

DBGET integrated database retrieval system