KEGG   Medicago truncatula (barrel medic): MTR_5g071360Help
Entry
MTR_5g071360      CDS       T01716                                 

Definition
Asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTR_5g071360
Enzymes [BR:mtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MTR_5g071360
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C44
   MTR_5g071360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 584 aa AA seqDB search
MCGILAVLGCSDPTRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD
QPLFNEDKSVIVTVNGEIYNHEALRKQLSNHTFRTGSDCDVIAHLYEEYGEDFVDKLDGI
FSFVLLDTRDNSYIVARDAIGVTSLYIGWGLDGSVWISSEMKALNDDCEHFECFPPGHLY
SSKDGGFRRWYNPPWYSEAIPSAPYDPLALRHAFEKAVIKRLMTDVPFGVLLSGGLDSSL
VASITSRYLATTKAAEQWGSKLHSFCVGLEGSPDLKAGKEVADYLGTVHHEFTFTVQDGI
DAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPN
KEEFHQETCRKIKALHQYDCQRANKSTFAWGLEARVPFLDKEFINVAMNIDPENKMIKKD
EGRIEKYILRKAFDDEENPYLPKHILYRQKEQFSDGVGYSWIDGLKAHAAKHVTDRMMLN
AGNIYPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGGPTVACSTAKAVEWDASWSKNLD
PSGRAALGVHDSAYENQKTLVNKPVEFEKIIPLEASPVEVAIQS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattcttgctgtgcttggttgctctgatcctactagagctaagagggttcgt
gtccttgagctttcacgcagattgaagcaccgtggccctgattggagtgggctccaccaa
catggtgactgctttttggcacaccaacggttagccatagttgatcctgcttctggggat
caacctctctttaatgaagacaaatctgtcattgtcacggtaaatggagagatttacaac
catgaagctctcaggaaacagctgtctaatcacacattccgaacgggaagtgattgtgat
gttattgcacacttgtacgaggaatatggagaagactttgtggacaagttggatggtatc
ttttcctttgttctattggatactcgtgataacagttacatagtggctagagatgctata
ggagtaacttccctatacattggttggggattggatggttctgtttggatttcatcagaa
atgaaagccttgaatgatgattgtgaacattttgagtgttttccacctggtcatttgtac
tctagcaaagatggtggatttagaagatggtacaatcctccctggtactctgaggctatt
ccatcagctccttatgatcctctagctttgaggcatgcctttgagaaggcagtgataaag
aggttgatgactgatgtgccttttggtgttctactatctggaggtttggactcatcattg
gttgcatccatcacttctcgctacctagcaaccactaaagctgctgaacaatggggatca
aaattacactcattctgcgttggccttgagggctcacctgatcttaaggctggaaaagaa
gttgcagattaccttggaactgttcaccatgagtttacctttactgttcaggatggtata
gatgcaattgaggatgttatataccatgttgaaacatatgatgtgactacaattagagca
agtacacctatgtttcttatgtcaaggaagattaaatcacttggtgtcaaatgggtgatc
tctggtgaaggatctgatgagatatttggtggatatctgtactttcacaaggcaccaaac
aaggaagagttccaccaagaaacatgccgcaagatcaaagcactccaccaatatgattgc
cagagagcaaataaatcaacctttgcttggggtctagaagccagagttccatttttggac
aaggagtttatcaatgttgcaatgaatattgatcctgagaataaaatgataaaaaaagat
gaaggacgaattgagaagtatattctgaggaaggccttcgatgatgaagagaatccttat
ctgccaaagcacattttatacaggcagaaggaacaattcagtgatggtgttggttatagt
tggattgatggccttaaagctcatgctgcaaaacatgtgactgataggatgatgcttaat
gctggcaatatctacccccacaacaccccaaacaccaaggaagcatactactacagaatg
atctttgagaggttcttcccccagaactcagcaaggctaactgttcctggaggaccaact
gttgcatgtagcacagctaaggctgttgagtgggatgcttcttggtccaagaaccttgat
ccttctggtagagcagcacttggagttcatgattcagcttacgaaaaccagaaaaccttg
gtcaacaaacctgtagaatttgagaagattataccattggaagcttctccagttgaggtt
gccattcagagctag

DBGET integrated database retrieval system