KEGG   Medicago truncatula (barrel medic): MTR_5g077000Help
Entry
MTR_5g077000      CDS       T01716                                 

Definition
(RefSeq) UTP-glucose 1 phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MTR_5g077000
   00052 Galactose metabolism
    MTR_5g077000
   00500 Starch and sucrose metabolism
    MTR_5g077000
   00520 Amino sugar and nucleotide sugar metabolism
    MTR_5g077000
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MTR_5g077000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 470 aa AA seqDB search
MATATETNLANLKSAVTGLDQISENEKTGFINLVSRYLSGEAQHVEWSKIQTPTDEVVVP
YDTLAPTPAGSSDIKNLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVVQIE
NLNSKYGSNVPLLLMNSFNTHDDTQKIIEKYQNHNIEIHTFNQSQYPRLVVDDFSPLPSK
GNTGKDGWYPPGHGDVFPSLSNSGKLDALLSQGKEYVFVANSDNLGAIVDLKILNHLIEH
KNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVGEFKSIEKFKIFNTNNLWV
NLKAIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDKAIGINVPRSRFLPV
KATSDLLLVQSDLYTLEDGSVIRNTARANPENPSIELGPEFKKVSNFLSRFKSIPSIVEL
DSLKVAGDVSFGASVILKGKVSIVAKSDVKLEIPDGAVIENKEINGPEDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgctaccgaaaccaatctcgccaatctcaaatccgctgttactggattggat
caaatcagcgagaatgagaaaaccggattcatcaacctcgtttctcgttacctcagtggt
gaagcgcagcatgtagaatggagtaagatccagacgccaactgatgaagttgttgtgcct
tatgatactttggcgccaactcctgctggttcgtcggatataaagaatcttttggataag
cttgtggtgttgaagcttaatggaggcttggggacaactatgggttgcactggtccaaaa
tccgtcattgaagttcgtgatgggttgacatttttagatttgattgtcgtccaaatcgag
aatctcaattccaaatatggaagcaacgttcctttgcttttgatgaactcattcaacacc
catgacgacactcaaaagattattgaaaagtaccaaaaccataatattgagatccataca
tttaaccagagccagtatcctcgattggttgttgatgacttttcgccattgccttccaaa
gggaacaccggcaaggatgggtggtaccctcctggccatggagacgtcttcccatcatta
tcgaacagtggaaaacttgatgcactattatcacagggtaaagagtacgtgtttgttgcc
aattcagataacttgggagctatagttgacttgaaaattttaaaccatctgatcgagcac
aagaatgaatattgtatggaggttactcccaaaacattggctgatgttaagggcggcact
ttgatttcttatgaaggaagggttcagctcctggaaattgcccaagtcccagatgaacac
gtcggcgaattcaagtcaatagagaaattcaaaattttcaacacaaataatttgtgggtg
aacttgaaagcaatcaaaagacttgtcgaagctgatgctcttaagatggagattattccc
aatccaaaggaagttgatggagtaaaagttcttcagctggaaactgcagctggtgcagca
ataaggttctttgacaaggctattgggattaatgttcctcgatcccggttccttcctgtg
aaggcaacttcagatttgcttcttgtccagtcagacctctacaccttggaagatggatct
gtcatcagaaacacagctagggctaatcctgaaaacccttccattgaactggggccagaa
tttaagaaggttagcaacttcttgagccgcttcaagtcaattcctagtattgttgagctt
gacagtctaaaagtggctggcgatgtgtcgtttggagctagtgtcatcctcaaggggaaa
gtcagtatcgtagcgaaatctgatgtaaagctggaaattcccgacggagccgtaattgaa
aacaaggaaattaatggcccagaggacctgtga

DBGET integrated database retrieval system