KEGG   Medicago truncatula (barrel medic): MTR_5g077000Help
Entry
MTR_5g077000      CDS       T01716                                 

Definition
UTP-glucose 1 phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MTR_5g077000
   00052 Galactose metabolism
    MTR_5g077000
   00500 Starch and sucrose metabolism
    MTR_5g077000
   00520 Amino sugar and nucleotide sugar metabolism
    MTR_5g077000
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MTR_5g077000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 470 aa AA seqDB search
MATATETNLANLKSAVTGLDQISENEKTGFINLVSRYLSGEAQHVEWSKIQTPTDEVVVP
YDTLAPTPAGSSDIKNLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVVQIE
NLNSKYGSNVPLLLMNSFNTHDDTQKIIEKYQNHNIEIHTFNQSQYPRLVVDDFSPLPSK
GNTGKDGWYPPGHGDVFPSLSNSGKLDALLSQGKEYVFVANSDNLGAIVDLKILNHLIEH
KNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVGEFKSIEKFKIFNTNNLWV
NLKAIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDKAIGINVPRSRFLPV
KATSDLLLVQSDLYTLEDGSVIRNTARANPENPSIELGPEFKKVSNFLSRFKSIPSIVEL
DSLKVAGDVSFGASVILKGKVSIVAKSDVKLEIPDGAVIENKEINGPEDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgctaccgaaaccaatctcgccaatctcaaatccgctgttactggattggat
caaatcagcgagaatgagaaaaccggattcatcaacctcgtttctcgttacctcagtggt
gaagcgcagcatgtagaatggagtaagatccagacgccaactgatgaagttgttgtgcct
tatgatactttggcgccaactcctgctggttcgtcggatataaagaatcttttggataag
cttgtggtgttgaagcttaatggaggcttggggacaactatgggttgcactggtccaaaa
tccgtcattgaagttcgtgatgggttgacatttttagatttgattgtcgtccaaatcgag
aatctcaattccaaatatggaagcaacgttcctttgcttttgatgaactcattcaacacc
catgacgacactcaaaagattattgaaaagtaccaaaaccataatattgagatccataca
tttaaccagagccagtatcctcgattggttgttgatgacttttcgccattgccttccaaa
gggaacaccggcaaggatgggtggtaccctcctggccatggagacgtcttcccatcatta
tcgaacagtggaaaacttgatgcactattatcacagggtaaagagtacgtgtttgttgcc
aattcagataacttgggagctatagttgacttgaaaattttaaaccatctgatcgagcac
aagaatgaatattgtatggaggttactcccaaaacattggctgatgttaagggcggcact
ttgatttcttatgaaggaagggttcagctcctggaaattgcccaagtcccagatgaacac
gtcggcgaattcaagtcaatagagaaattcaaaattttcaacacaaataatttgtgggtg
aacttgaaagcaatcaaaagacttgtcgaagctgatgctcttaagatggagattattccc
aatccaaaggaagttgatggagtaaaagttcttcagctggaaactgcagctggtgcagca
ataaggttctttgacaaggctattgggattaatgttcctcgatcccggttccttcctgtg
aaggcaacttcagatttgcttcttgtccagtcagacctctacaccttggaagatggatct
gtcatcagaaacacagctagggctaatcctgaaaacccttccattgaactggggccagaa
tttaagaaggttagcaacttcttgagccgcttcaagtcaattcctagtattgttgagctt
gacagtctaaaagtggctggcgatgtgtcgtttggagctagtgtcatcctcaaggggaaa
gtcagtatcgtagcgaaatctgatgtaaagctggaaattcccgacggagccgtaattgaa
aacaaggaaattaatggcccagaggacctgtga

DBGET integrated database retrieval system