KEGG   Medicago truncatula (barrel medic): MTR_5g080780Help
Entry
MTR_5g080780      CDS       T01716                                 

Definition
Histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MTR_5g080780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 466 aa AA seqDB search
MGQKQKHALKSDPNDETKKKRRVGFSGIDAGVEAKDCIRIFLVSSKEEFDAPESFIINPV
DLNSYFDDDGKIYGYEGLKINIWVSRISFYAYADIAFDSSADRGKGITDLKVALQAIFAE
TLVDNKDEFLQKYLMDKDFVSKSISTGEILKHKAFKHADSDDSNVEVVRLKAGNMATGQL
YSHIIPLVLLLVDGSSPIDVTDSMWELYVVVQKKTDQQGEIQCLLLGFTAIYRFYHYPDN
SRLRLGQILVLPPYQHKGYGRYLLEVLNDVAIAENVFDLTVEEPLDNFQHVRSCVDTQRL
LGFEPIQHLVTKAVSLLKDGKLSKRTHSPRLTPPPSAVEDVRKHLKITKTQFLKCWEVLI
YIGLNPIDKYLENFVSVISERVKYDILGKDSGTAGKQLIEVPCNVNEEMSFVMFKSGAGE
DIAVQMDDNQTSQEEQLRKLVQDRVKEIQLIAEKVTSPLGSSEVAN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaagcagaagcacgctttgaaatcagatcccaacgatgaaaccaagaagaaa
cgccgtgttggattttccggcatagatgctggggttgaagccaaagactgcatcagaatc
ttccttgtttcaagcaaagaagagtttgatgctccagagagttttatcatcaatcctgtg
gatttgaatagctatttcgatgatgatgggaaaatttatggctatgagggtttgaagatt
aacatctgggttagcagaatatcattttatgcatatgctgatattgcattcgacagttcc
gctgatcgaggcaaagggataacagatcttaaagttgctcttcaggcaatttttgctgag
actcttgttgataacaaggatgaattccttcaaaagtatttgatggacaaggattttgtt
agtaaaagcatctcaactggggagattttgaagcacaaagctttcaagcatgctgattcg
gatgattctaatgttgaggttgtgcgtttgaaagcaggcaacatggctactggacaactt
tacagtcatataataccccttgttcttctccttgttgatggtagcagtcccattgatgtt
accgattcaatgtgggagctgtatgtcgtggttcagaagaaaactgatcagcagggagag
atccaatgtttgttgcttggatttactgccatttatcgattttaccactatcccgataac
tcccgattgcgtctgggtcagatactggtattgcctccatatcagcacaagggttatggg
cgttaccttctcgaagtgctcaatgatgttgctatagctgaaaatgtttttgacctcact
gtagaagagccgttagataacttccaacatgtccgttcctgtgttgacacacaacgcctg
cttggttttgagccaatccagcatttagttactaaggctgtttcactcctgaaggatgga
aaactatcaaagagaacacattctcctcgacttacaccacctcccagtgctgttgaggat
gtaaggaaacatttgaaaattaccaagacacagtttctcaagtgttgggaggttttgatc
tacattggcctcaatcctattgacaagtacctggagaactttgtcagcgttatttctgaa
cgtgtgaagtatgatattttggggaaagattctgggactgctgggaagcaacttattgaa
gttccttgcaatgtcaatgaggagatgtcatttgtcatgttcaaatcaggggctggtgaa
gatattgctgtacagatggatgacaatcagacaagccaagaagagcaactccgaaagtta
gttcaggatagggtgaaggaaattcagttgattgctgaaaaggtaacctcgcctcttggg
agttcagaggtggctaattga

DBGET integrated database retrieval system