KEGG   Medicago truncatula (barrel medic): MTR_5g081230Help
Entry
MTR_5g081230      CDS       T01716                                 

Definition
Serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    MTR_5g081230
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MTR_5g081230
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     MTR_5g081230
Transcription machinery [BR:mtr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     MTR_5g081230
Spliceosome [BR:mtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    MTR_5g081230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 324 aa AA seqDB search
MSAQGQPPPPQLQAQVIDETVLDDIIRRLTEVRLSRPGKQVQLSEAEIKQLCSASRDIFL
QQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGLPPQSNYLFLGDYVDRGKQSLETICLL
LAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKAFTESFNCLPVAALIDE
KILCMHGGLSPDLTNLDQIRNLPRPVPIPDTGLLCDLLWSDPGKDVKGWGMNDRGVSYTF
GPDKVAEFLTRHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDE
NLMCSFQILKPAEKKTKFVMSNKM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacaaggacaaccaccaccaccacagctacaagctcaggtgattgatgagacg
gtgctggatgacattatccggcgactcacggaggtccgattatctcgacctggaaagcaa
gttcagttatctgaagctgagatcaagcagctttgttctgcttctagagatatctttctt
caacaacctaatttgcttgaacttgaagctcctattaagatttgtggtgacattcacggg
cagtacagtgatttgttaagactctttgagtatgggggtttgccccctcaatctaattat
ctctttttaggggactatgtcgatcgtgggaagcagagcttagaaaccatatgtcttttg
cttgcttataaaatcaaatatcctgaaaactttttccttttgaggggaaatcacgagtgt
gcttccattaataggatatatggcttttatgatgaatgcaagcgaaggtttaatgtgagg
ctttggaaagcctttacagaatcttttaactgccttcctgtggcagctcttatagatgag
aaaatattgtgcatgcatggtggtctttcccctgacctcacaaatttggaccaaatccgg
aatctgcctcgtccagttcctattcccgacactggtttgctctgtgatttgctttggtct
gatcctggtaaagatgtgaagggttggggcatgaacgatagaggagtgtcctacactttt
ggccccgataaggtggctgaatttttgacaaggcatgacttggaccttatttgtcgtgct
catcaggttgtagaggatgggtatgaattttttgcagacagacaacttgttacaatattt
tcagctccaaactactgtggtgaatttgacaatgctggtgcaatgatgagtgtggacgag
aacttaatgtgctccttccagattcttaagcctgcagagaagaaaacaaagttcgtgatg
tcaaacaagatgtga

DBGET integrated database retrieval system