KEGG   Medicago truncatula (barrel medic): MTR_5g082590Help
Entry
MTR_5g082590      CDS       T01716                                 

Definition
(RefSeq) phosphoinositide-specific phospholipase C family protein
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MTR_5g082590
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MTR_5g082590
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MTR_5g082590
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MTR_5g082590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 582 aa AA seqDB search
MFKRFNRNISFSEQEQLPPSDVKEVFSEFSNGGSALSADQLRQFLVEHQSETNCTEDDSN
RIVQNAIQSRKSGVAGDGISGTGEELTLEEFFQFLFYDEFNGPIKSQVHHDMNAPLSHYF
IYTGHNSYLTGNQLSSDCSDVPIIKALQRGVRVIELDLWPNSAKDDIVVVHGRTLTTPVS
LVQCLKSIKEYAFVKSRYPVVITLEDHLTPDLQAKVAEMTTQIFGDMLYFPHTETMTEFP
TPESLKDRVLISTKPPKEYLDSKQFKDTSDSEREMGEEGSLSPALSVECDERCSGSDLDE
EGLNPRDKKPDQQSAPQYKRLITIHAGKPKGHIRDHLKVAGDVKRLSLSEQELEKASASY
GADIVRFTQKNILRVYPKGTRVTSSNYRPHIGWMYGAQMVAFNMQGHGKSLWYMQGMFRA
NGGCGYVKKPVFLMEKGPHSECFDPKRTLPVKKTLKVKVYMGNGWNSDFSKTHFDTFSPP
DFYTKVCIVGVPADEVNKKTKVNKDNWFPIWDEEFDFPLSVPELALLRIEVREHDKHEKD
DFGGQTCLPVSELKSGFRAVPLYDQKGEKLKSVKLLMRFQFT
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgtttcaacagaaatatctcattctccgaacaagaacaattaccaccatct
gatgtcaaggaagttttttccgaattctccaacggcggatcagcattgtctgctgatcag
ctacggcaatttttggttgaacatcaaagcgaaactaactgcaccgaagatgattcaaac
cggatcgttcaaaatgcaatacaatcgcggaaaagtggtgttgctggtgatggcatttcc
ggcaccggagaggaactcacccttgaagaattcttccagtttttgttctatgatgaattt
aatggtcccataaaatcacaggtacaccatgacatgaatgccccgttatcacattatttc
atatacacaggacacaattcctatctaactggcaatcagctaagcagtgattgcagtgat
gtaccaatcataaaggcgttgcaacgaggcgtgcgcgttatagaactcgatttatggcca
aattcagctaaagatgatatcgttgtagttcatggaaggacacttacaactcctgtctca
ctagtccaatgtttgaagtccataaaagaatatgcatttgttaaatctcgctaccctgtc
gttataactttagaagatcatcttacaccagatcttcaagctaaagttgcagagatgaca
actcaaatatttggagatatgctctattttccgcatacagaaactatgacagaattccca
acaccagaatcactaaaagatcgagttcttatatcgacgaaaccgccaaaagaatatctt
gattccaaacaatttaaggatactagtgacagtgaaagggaaatgggtgaagaaggatca
ttgtcaccagcccttagtgttgaatgtgatgaaagatgcagtggaagtgatcttgatgag
gaaggtttgaatcctcgtgataaaaagccagaccagcaaagcgcaccacagtacaaacgt
ttgattacaatccatgctggtaagcccaagggtcatataagggaccacctaaaagttgct
ggtgatgttaagcgtttgagcttgagtgagcaagaacttgaaaaggcttcggcttcttat
ggagctgatattgttaggtttacacagaagaatattcttagggtgtatccaaagggaaca
cgtgtcacctcttcgaattacaggccacatatagggtggatgtatggagctcagatggtc
gcatttaacatgcaggggcatggaaaatcactttggtatatgcaaggaatgtttagagca
aatggagggtgtggttatgtgaaaaagcctgtttttcttatggagaaaggtccacacagt
gagtgttttgatcctaaaagaacactgccagtgaagaagacattgaaggtgaaagtatac
atgggaaatgggtggaactcagattttagcaaaacacactttgatacattctctcctccg
gacttttacacaaaggtttgtattgttggagtaccggctgatgaagtcaataagaagacc
aaagtaaataaagataattggtttccaatttgggatgaagagtttgattttcctttgagc
gttccagagcttgctttgcttaggattgaagttagagagcatgataagcatgaaaaggat
gattttggtggacaaacatgtttgccagtttctgagctgaaatctggattcagagcagtt
cctttatatgatcaaaagggtgagaaattaaaatctgtaaagcttttaatgcggtttcag
ttcacatga

DBGET integrated database retrieval system