KEGG   Medicago truncatula (barrel medic): MTR_5g082900Help
Entry
MTR_5g082900      CDS       T01716                                 

Definition
Clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MTR_5g082900
Exosome [BR:mtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MTR_5g082900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1706 aa AA seqDB search
MAAANAPIAMKEVLTLPSVGINAQFITFTHVTMESDKYICVRETSPQNSVVIVDMSMPNQ
PLRRPITADSALMNPNSRILALKAQLQGTTQDHLQIFNIELKTKMKSHQMPEQVVFWKWI
SPKMLGLVTQTSVYHWSIEGDSEPVKVFERTANLANNQIINYRCDPTEKWLVLIGIAPGS
PERAQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSVLISFASKTFNAGQVIS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQISHKYSLIYVITKLGLLFVYDL
ETATAVYRNRISPDPIFLTSEATSAGGFYAINRRGQVLLATVNEQTIVNFVSGQLNNLEL
AVSLAKRGNLPGAEKLVVERFHELFSQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNAFESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILVYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGSPIDYNTITDLFLQRNLIREATAFLLDVLKPNLPEHGFLQTKVLE
INLVTFPNVADAILANGMFSHYDRPRVAQLCEKAGLYVRALQHYTELPDIKRVIVNTHAI
EPQSLVEFFGTLSREWALECMKDLLLANLRGNLQIIVQVAKEYSEQLSVEGCIKIFEQFR
SYEGLYFFLGSYLSSSEDPDIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPENFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDEELINVTSKNSLFKLQARY
VVERMDGDLWDKVLNPDNEYRRQLIDQVVSTALPESSSPEQVSATVRAFMTADLPHELIE
LLEKIVLQNSAFSGNHNLQNLLILTAIKADSSRVMDYINRLDNFDGPSVGEMAVEAQLYE
EAFAIYKKFNLNVQAVNVLLDNIRSIDRAVEFAFRVEEDAVWSQTAKAQLREGLVSDAIE
SFIRADDTTQFLDVIRAAEDANVYHDLVKYLLMVRQKAKEPKVDGELIYAYAKIDRLSDI
EEFILMPNVANLQTVGDRLYDEALYEAAKIIFAFISNWAKLAITLVKLQQFQGAVDAARK
ANSSKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGYFNELISLMESG
LGLERAHMGIFTELGVLYARYRPDKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTFLYI
QYDEFDNAATTIMNHSPEAWDHMQFKDVAVKVANVELYYKAVHFYLEEHPDLINDILNVL
ALRVDHTRVVDIMRKAGHLRLVKPYMVAVQSSNVSAVNEALNEIYVEEEDYDRLRESIDL
HDNFDQIGLAQKIEKHELLEMRRVAAYIYKKAGRWKQSIALSKKDNLYKDAMETASQSGE
RELAEELLVYFIDQGKKECFASCLFVCYDLIRADVVLELAWMHNMIDFAFPYVLQFIREY
TGKVDELVKDRIEAQNEVKSKEKEEKDVVAQQNMYAQLLPLALPAPPMPGMGGPGYGGSY
GPPPPVSGMGMPQMPPFGMPPMGSSY
NT seq 5121 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgaacgctccgatcgccatgaaagaagtcctaaccttaccgagtgttgga
atcaatgcacaattcatcacattcacgcatgtgacgatggaatcagacaagtatatatgt
gttcgagaaacgtctccacagaatagtgttgttattgttgatatgagcatgccaaatcaa
cctttgaggaggccaattactgcggattccgctcttatgaatcctaattctagaatcctt
gctttgaaagcccaactccaagggactacacaggatcacctacaaatatttaacattgaa
ttgaaaacaaagatgaaatcgcatcagatgcctgagcaggtagtcttttggaagtggatt
agccccaaaatgttgggcctcgtgacacaaacctcagtataccactggtccattgaaggt
gattctgaacctgttaaggtatttgagagaacagcaaatttggcgaacaaccagataatc
aattatcgatgcgaccctacagaaaaatggttggtcttgattggtatcgctcctggttcc
cccgagagggcacaattggttaaagggaacatgcagcttttctccgtggatcagcagcgt
agtcaggctcttgaagctcatgctgcatcatttgcccaattcaaagttcctgggaatgaa
aatccgtctgttttgatttcttttgcctcaaagacatttaatgctggtcaagttatatcg
aagttacatgtcattgaactgggcgcacagccagggaagccatcatttacaaagaaacaa
gcagatctcttcttccctccagattttgctgatgactttccagttgcaatgcagatatcc
cacaaatatagtttgatttatgtgatcaccaaacttgggctactttttgtatatgatttg
gagacagctaccgctgtatataggaacaggattagtccagatcctatatttttgacatca
gaagccacatcagcaggaggcttttatgccattaataggagaggccaagttttgttggcc
actgtcaatgaacaaacaattgtgaattttgtcagcggtcaattaaacaatttggagcta
gctgttagtcttgcgaaaagagggaatcttcctggtgctgagaagctggttgtggagcgt
tttcatgaattgttttcccaaacaaagtataaagaagcagcagagcttgctgctgaatct
ccacaaggaatccttcggacccctgacacagttgccaaatttcagagtgttcccgtgcaa
gctggtcaaacgccgccgctgctgcagtattttggaacacttttaacgagaggaaagctg
aatgccttcgaatcattagaattgtctcggttggtagtgaaccagaacaagaaaaacctg
ttggaaaattggttggcagaggacaagcttgaatgcagtgaggagctaggagatctcgtt
aagactgtggacaatgatcttgctttaaaaatatacatcaaagccagagctactccgaaa
gttgttgctgcttttgctgagaggagggagtttgataagattctggtctactctaagcag
gttggatacacacctgactaccttttcctcttgcaaacaattctccgaacagatcctcag
ggtgctgttaattttgcattaatgatgtctcaaatggagggaggtagcccaattgattac
aacaccataactgatctgtttcttcagagaaacctgatccgtgaggcaacagcttttctc
ctggatgttttaaagccaaatttacctgaacatggattccttcaaacaaaggtgttggag
ataaatctggtcactttccctaatgttgctgatgctattttggctaatggcatgttcagc
cattatgaccgtcctcgtgttgcccagctttgtgaaaaagctggcctttacgtgcgagct
ttgcaacattacacagagttaccagatataaaacgtgttattgttaatacacatgctatt
gagcctcagtcacttgtagaattttttggtactctctcacgagaatgggcattagagtgc
atgaaagacttgttactggccaatcttaggggcaatttacagattattgtgcaggttgcc
aaagaatattctgaacaattgagcgttgaaggttgcattaaaatttttgagcagtttagg
tcatatgaagggctgtacttttttcttggctcatatttgagctccagcgaggaccccgac
attcatttcaagtatattgaggcagcagcgaagactggtcaaatcaaggaggttgagcgt
gtgacaagagaatccaatttctatgatgccgaaaaaacaaagaacttcctaatggaggct
aagcttccagatgcacgacctttaatcaatgtttgtgatcgatttgggtttgttccagat
ctgacacactacctatacacaaacaacatgcttcgctacattgaaggttatgttcagaag
gtgaacccagggaatgctcctttagttgttgggcagctgctagatgacgagtgccctgaa
gattttatcaaaggtttgattctttctgttcgttccttgctgccagtggagccccttgtg
gaggagtgtgagaagaggaatcgccttcgtttgctcacacagtttttggaacatctcgtg
agtgagggaagccaggatgtacatgttcacaacgccctgggtaaaattatcattgatagc
aacaacaacccagaaaattttctcacaaccaacccttactatgattctcgagttgtgggc
aagtattgtgagaaacgcgacccaaccttggcagttgtagcttaccggcgaggacaatgt
gatgaagaacttatcaatgtcaccagtaaaaattctttgttcaaactgcaagcaaggtat
gtcgttgagagaatggacggcgatctttgggataaagttcttaatcctgataatgaatat
agaaggcaacttattgatcaggttgtatctactgctttgcctgaaagctcaagccctgaa
caagtttctgcaactgttagggctttcatgacagctgatctgcctcatgaattgattgaa
cttctcgagaagattgtccttcagaattctgcattcagtgggaaccacaatttgcagaat
cttctcattttgacagcgataaaggctgattcatccagagttatggattatatcaataga
ctggataattttgacgggccttcagttggggaaatggctgtagaagcacagttgtatgag
gaagcatttgcaatttacaagaagttcaacttgaatgttcaagcagtcaatgtgttgctt
gataatattcgcagcattgatagagctgttgagtttgctttcagagttgaagaagacgct
gtttggagtcagacggcaaaggctcaactcagggaagggcttgtaagtgatgcaatagag
tcatttatacgagcagatgatactacacaatttttggatgttatccgtgctgctgaagat
gccaatgtttaccatgacttggttaaatacttgttaatggtaagacagaaggcaaaagaa
ccaaaggttgacggcgagctcatttatgcatatgcaaaaattgacaggcttagtgacatt
gaagagttcattctgatgccaaatgttgctaatttgcaaactgttggggaccggttgtat
gatgaagcattatacgaggctgcaaaaatcatatttgcctttatatctaactgggccaag
ttggctattacactggtcaaattacaacaattccaaggggcagttgatgcagctaggaaa
gctaacagctcaaaaacatggaaggaagtttgttttgcgtgtgttgatgcagaggagttt
cgtttggcccagatatgtggactcaacattattattcaggtggatgacttggaagaggtc
agtgaatattaccaaaatagaggttacttcaatgagttaatatctctcatggagagtggt
ttagggttagaacgagcacatatgggcatcttcaccgagctaggagttctttatgctaga
taccgccctgataagcttatggagcatatcaaactattctcaacccgcctcaatatccca
aaacttattagagcatgtgatgaacaacaacattggaaagaattgacctttttgtatatc
caatatgatgagtttgataatgccgcaactaccatcatgaaccattcacctgaagcgtgg
gatcacatgcagttcaaggatgttgccgtcaaagttgctaatgttgagttgtattacaag
gctgttcacttctatctggaagaacatccagacctcatcaatgatattctgaatgtcctt
gcacttcgtgtggaccacacacgtgttgttgacatcatgcgtaaggctggtcacctccgt
cttgtgaagccatacatggttgcagttcagagcagcaacgtttctgctgttaatgaagcc
ctgaatgagatatatgttgaggaggaagattatgatagattgcgggagtcaattgatttg
catgataatttcgatcaaataggccttgcacaaaagattgaaaagcatgagcttcttgag
atgaggcgtgttgctgcttatatttacaagaaggcaggaaggtggaagcagtccattgct
ttatcaaagaaggacaacctttacaaagatgccatggagacagcttcacaatctggcgag
cgtgaacttgccgaggagttgcttgtttatttcattgatcagggaaagaaggaatgcttt
gcctcatgtctatttgtttgctatgatttaatacgagcagacgttgttcttgaactagct
tggatgcacaatatgattgactttgccttcccatacgtcttgcagtttatccgtgaatac
actggcaaagttgatgagctagtgaaagacagaattgaagcacaaaatgaagtgaagtct
aaagagaaagaagaaaaggacgtagttgcacagcagaacatgtatgctcaattgttacct
cttgctttgcctgccccaccaatgcctggaatgggaggaccaggttatggaggaagctac
gggcctccccctccagtgagtggaatggggatgccccaaatgcctccttttgggatgcca
cccatgggtagcagttactaa

DBGET integrated database retrieval system