KEGG   Medicago truncatula (barrel medic): MTR_5g084030Help
Entry
MTR_5g084030      CDS       T01716                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTR_5g084030
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTR_5g084030
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MTR_5g084030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 391 aa AA seqDB search
MEPLISLKGHFHVFPSFSSNPRTTIPPTQVITYRKNSIFTLSVRAQVDPNEGSATIATSG
ESVVEALKVKEWEVGMFHNEVAATQGIRIRRRPPTGPPNHYVGPFQFRLQNEGNTPRNIL
EEIVWNKDNEVAQLKERKPLITISKALGNAPPVRDFIGALRAANERTGLPGLIAEVKKAS
PSRGILRENFDPVEIAQSYEKGGAACLSVLTDEKYFKGSFENLELIRNAGVKCPLLCKEF
IIDAWQLYYARSKGADAVLLIAAVLPDLDIKYMVKICKLLGLTALVEVHDEMEFDRVLGI
EGVELIGINNRNLETFELDISTTKKLLEGERGKIIRERNIIMVGESGLFTPEDIAYVQEA
GVKAVLVGESIVKQSDPGKGISNLFGKDISV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgttgatttctctcaagggtcactttcatgtcttcccttcattctcttcaaac
cccagaaccactattcctccaactcaagtcattacgtatagaaaaaactcaatttttacg
ttatctgttcgagcacaggtggatccaaatgaaggttcggctacaatagccacatctggt
gaatctgtggttgaagctctcaaagttaaggaatgggaagtaggaatgtttcataatgag
gttgctgctacccaaggaataagaataaggagaagaccaccaactggaccccctaatcat
tatgtaggaccttttcaattccggttgcagaatgagggcaatacaccgcgtaacatcttg
gaagagatcgtgtggaacaaggacaacgaagtcgcacaactcaaagaaagaaaacccctt
attacgattagcaaggcccttggaaatgcacctcctgttcgggattttatcggggctcta
agggcggctaatgagcgaactggattgccgggattgattgctgaagtgaagaaggcttca
ccaagtagaggcatcttgagagaaaattttgatcctgttgaaattgctcaatcttatgag
aaaggtggagcagcatgtctgagtgttctaacagatgagaagtattttaagggaagcttt
gaaaatttggagttaataagaaatgctggagtaaagtgccctttgttgtgcaaagaattc
atcatagatgcttggcagctctactatgctcgatcgaaaggtgcagatgcagtgcttcta
attgctgctgttttacctgatcttgacatcaaatacatggttaagatatgcaaattactt
ggactgacagctcttgttgaggtgcacgatgagatggaattcgatcgtgttcttggaata
gagggcgttgagcttattggcatcaacaaccgtaatcttgaaacatttgagttagatatc
agcaccacgaagaagcttcttgaaggagagcgaggcaaaataatccgtgagagaaacata
attatggttggggaatctggtcttttcacacctgaagatattgcttatgtacaagaagca
ggagttaaagctgttttggtgggagagtctattgtgaaacaaagtgatcctggaaaggga
attagcaatctctttggcaaagatatatctgtttga

DBGET integrated database retrieval system