KEGG   Medicago truncatula (barrel medic): MTR_5g084930Help
Entry
MTR_5g084930      CDS       T01716                                 

Definition
Protein disulfide isomerase family
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MTR_5g084930
Enzymes [BR:mtr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MTR_5g084930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 435 aa AA seqDB search
MAKLSFIAVTIFLFNNLILSHALYGSSSPVLQLTPNNFKSKVLNSNGVVLVEFFAPWCGH
CKALTPIWEKAATVLKGVVTVAALDADAHQSLAQEYGIRGFPTIKVFSPGKPPVDYQGAR
DVKPIAEFALQQVKALLKERLNGKATGGSNEKKESTASSSVELNSSNFDELVIKSKELWI
VEFFAPWCGHCKKLAPEWKRASNNLKGKVKLGHVDCDADKSLMSRFNVQGFPTILVFGAD
KDTPIPYEGARTAAAIESFALEQLETNVAPPEVTELYSPDVLEEKCGSAAICFVSFLPDI
LDSKAEGRNRYLQQLLTVAEKFKRSPYSYVWAAAGKQPDLEQKVGVGGYGYPALVALNVK
KGVYAPLKSAFELDQIIEFVKEAGRGGKGNLPLGDTPPTIVKTEPWDGKDGEIVEEDEFS
LEELMGEDASTKDEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctcattcattgctgtaactatctttctcttcaacaatctcatcctttct
cacgctctctacggttcttcctcacctgttcttcaactcactcctaacaacttcaagtcc
aaggttctgaattcaaatggagttgttcttgttgaattctttgctccatggtgcgggcac
tgtaaggctctgactccaatatgggagaaggcagctactgtgttaaagggtgtagttact
gtagcagcacttgatgctgatgctcaccaatctctggctcaggaatatggtattagagga
tttccaactataaaggtgttttcacctggaaaaccaccagttgattaccaaggagccaga
gacgttaaaccgatcgcagaatttgcacttcaacaggtaaaggctcttttgaaggaacgg
ttaaatggaaaagcaacaggtggatcaaatgaaaaaaaagaaagcaccgcttcttcttcg
gtagaactaaactctagtaacttcgatgaattggttatcaaaagcaaagaactttggatt
gtagaatttttcgcaccttggtgtggccattgcaaaaaattagctcctgagtggaaaaga
gcatccaataatttgaaagggaaggttaaactgggtcatgttgactgtgatgctgacaag
tctctgatgagcaggttcaatgttcaaggattcccaacaatcttggtatttggagccgat
aaagatactccaattccttacgagggtgctagaactgcagcagccatcgaatcattcgca
ctagagcagctggaaacaaatgttgctcctccagaagtgacagagctatatagtccagat
gttttggaagagaaatgtggttctgctgctatctgttttgtttccttccttcccgacatt
ttggattccaaggctgaggggagaaacagataccttcagcagttattaacagttgcagag
aagttcaaaaggagtccttacagctatgtatgggcagctgccggtaagcagccagatctt
gagcagaaagttggtgttggtgggtatggttatccagcattagtagccttgaacgttaag
aaaggtgtttatgctcctctcaaaagtgcttttgaacttgaccaaattatagaatttgtg
aaagaagctggacgcggaggcaaagggaacttgcccctaggtgacactcctcccaccatt
gtaaagacagaaccatgggatggaaaagatggagaaatagttgaggaggatgaattttct
cttgaagaactcatgggagaagatgcctcgaccaaagatgaactataa

DBGET integrated database retrieval system