KEGG   Medicago truncatula (barrel medic): MTR_5g084930Help
Entry
MTR_5g084930      CDS       T01716                                 

Definition
Protein disulfide isomerase family
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mtr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 435 aa AA seqDB search
MAKLSFIAVTIFLFNNLILSHALYGSSSPVLQLTPNNFKSKVLNSNGVVLVEFFAPWCGH
CKALTPIWEKAATVLKGVVTVAALDADAHQSLAQEYGIRGFPTIKVFSPGKPPVDYQGAR
DVKPIAEFALQQVKALLKERLNGKATGGSNEKKESTASSSVELNSSNFDELVIKSKELWI
VEFFAPWCGHCKKLAPEWKRASNNLKGKVKLGHVDCDADKSLMSRFNVQGFPTILVFGAD
KDTPIPYEGARTAAAIESFALEQLETNVAPPEVTELYSPDVLEEKCGSAAICFVSFLPDI
LDSKAEGRNRYLQQLLTVAEKFKRSPYSYVWAAAGKQPDLEQKVGVGGYGYPALVALNVK
KGVYAPLKSAFELDQIIEFVKEAGRGGKGNLPLGDTPPTIVKTEPWDGKDGEIVEEDEFS
LEELMGEDASTKDEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctcattcattgctgtaactatctttctcttcaacaatctcatcctttct
cacgctctctacggttcttcctcacctgttcttcaactcactcctaacaacttcaagtcc
aaggttctgaattcaaatggagttgttcttgttgaattctttgctccatggtgcgggcac
tgtaaggctctgactccaatatgggagaaggcagctactgtgttaaagggtgtagttact
gtagcagcacttgatgctgatgctcaccaatctctggctcaggaatatggtattagagga
tttccaactataaaggtgttttcacctggaaaaccaccagttgattaccaaggagccaga
gacgttaaaccgatcgcagaatttgcacttcaacaggtaaaggctcttttgaaggaacgg
ttaaatggaaaagcaacaggtggatcaaatgaaaaaaaagaaagcaccgcttcttcttcg
gtagaactaaactctagtaacttcgatgaattggttatcaaaagcaaagaactttggatt
gtagaatttttcgcaccttggtgtggccattgcaaaaaattagctcctgagtggaaaaga
gcatccaataatttgaaagggaaggttaaactgggtcatgttgactgtgatgctgacaag
tctctgatgagcaggttcaatgttcaaggattcccaacaatcttggtatttggagccgat
aaagatactccaattccttacgagggtgctagaactgcagcagccatcgaatcattcgca
ctagagcagctggaaacaaatgttgctcctccagaagtgacagagctatatagtccagat
gttttggaagagaaatgtggttctgctgctatctgttttgtttccttccttcccgacatt
ttggattccaaggctgaggggagaaacagataccttcagcagttattaacagttgcagag
aagttcaaaaggagtccttacagctatgtatgggcagctgccggtaagcagccagatctt
gagcagaaagttggtgttggtgggtatggttatccagcattagtagccttgaacgttaag
aaaggtgtttatgctcctctcaaaagtgcttttgaacttgaccaaattatagaatttgtg
aaagaagctggacgcggaggcaaagggaacttgcccctaggtgacactcctcccaccatt
gtaaagacagaaccatgggatggaaaagatggagaaatagttgaggaggatgaattttct
cttgaagaactcatgggagaagatgcctcgaccaaagatgaactataa

DBGET integrated database retrieval system