KEGG   Medicago truncatula (barrel medic): MTR_5g086700Help
Entry
MTR_5g086700      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1123 aa AA seqDB search
MTIMTPAPIDQQQQEDEEMLVPHAVPHADLAENNNHQPMDVVAQPETANTVEPVEDPSPS
RFTWRIDNFSRVNLKKLYSDVFVVGSYKWRVLIFPKGNNVDYLSMYLDVADSTSLPYGWS
RYAQFSLAVVNQIHNKYTVRKDTQHQFNARESDWGFTSFMPLGELYDPSRGYLMNDTLII
EAEVLVRRIVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTEN
DMPSGSIPLALQSLFYKLQYSDTSVATKELTKSFGWDTYDSFLQHDVQELNRVLCEKLED
KMKATVVEGTIQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCPDVYASFDKYVE
VERLEGDNKYHAEQYGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPL
QLDLDRDNGKYLSPDADRNVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDER
VTKEDPKRAMEEQYGGEEELPQTNPGFNNTPFKFTKYSNAYMLVYIREADKEKVICNVDE
KDIAEHLRERLKKEQEEKEHKKKEKAEAHLYTIIKVARDEDLGEQIGKDIYFDLVEHDKV
RSFRVQKQTPFNVFKEEVAKEFGIPVQFQRFWLWAKRQNHTYRPNRPLTQIEEAQSVGQL
REISNKVHNAELKLFLEVERGPDLCPIAPPEKTKDDILLFFKLYDPEKEELRFVGRLFVN
NTGKPSEILARLNKMAGYDPEEEIGLYEEIKFEPNVMCEPIDKKLTFRASQLEDGDIICF
QKAPATDNEEHIRYPDVPSYLEYVHNRQVVHFRSLDKPKEDDFCLEMSRLFTYDDVVERV
AEQLGLDDPSKIRLTPHNCYSQQPKPQPIKYRGVEHLSDMLVHYNQTSDILYYEVLDIPL
PELQGLKTLKVAFHHATKDEVVIHTIRLPKQSTVGDVLEDLKKKVELSRPDAELRLLEVF
YHKIYKVFPPNEKIENINDQYWTLRAEEIPEEEKNLGPHDRLIHVYHFTKDTTQNQMQIQ
NFGEPFFLVIHECETLAEIRLRIQKKLQVPDDEFGKWKFAFFSLGRPEYLEDSEVVSNRF
QRRDVYGAWEQYLGLEHTDNAPKRSYAANQNRHTFEKPVKIYN
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatgactcctgctcccattgaccaacaacagcaggaagatgaagagatgctt
gtgccgcacgcggttccgcatgcggatttggctgagaacaataatcatcaaccaatggat
gtggttgctcaacctgaaactgccaacactgtggagcctgtcgaggatccttcaccatca
agattcacatggagaattgacaacttttctagggtgaatttgaaaaagctctattcagat
gtatttgttgttgggagttacaaatggcgtgtacttatttttccaaaagggaacaacgtg
gactatttgtccatgtatttggatgttgcagattcaactagtctgccctacggttggagt
agatatgcacagtttagcttggctgttgttaatcagatccataataagtacaccgtgaga
aaagatacgcagcatcagttcaatgcacgggaaagtgactggggtttcacatccttcatg
cctcttggtgaattgtatgatcctagtagagggtatcttatgaatgatactcttataatt
gaagctgaggtccttgtccgtaggattgttgattactggacatatgattcaaaaaaggag
actggatatgttgggcttaagaaccagggagctacatgttatatgaattctctgcttcaa
actctgtatcatattccttatttccgaaaggctgtataccacatgcctacaacagagaat
gatatgccctctggaagcatccccctggctctgcaaagtttgttctacaagctccagtat
agtgacaccagtgttgcaacaaaagagctgacaaaatcttttggatgggatacatatgat
tctttcttgcagcatgatgttcaagaactaaatagagtcctttgtgaaaaacttgaagac
aaaatgaaggcaactgttgttgagggaactatacagaaattgtttgaagggcaccatatg
aactacatcgagtgcatcaatgtggactataaatcaacacgaaaggagtcattttatgat
cttcaacttgatgtcaaaggttgtcctgatgtttatgcttcctttgacaagtatgttgaa
gttgaacgtcttgagggggacaacaaataccatgctgaacaatatggtttgcaggatgct
aagaaaggtgtcctgttcatcgattttcctccagtcttgcagcttcagctgaaaagattt
gaatatgactttatgcgggatactatggtaaagattaatgatcgttatgagtttccattg
caacttgatcttgatcgtgacaatggaaaatatctatcacctgatgctgataggaatgtc
cgcaatctttacacacttcatagcgttctggttcacagtggtggtgtgcatggtggacat
tactatgcttttatcaggccaactctctctgatcagtggtacaaatttgatgatgagagg
gtgacaaaagaagaccctaaacgggcaatggaggagcaatatggtggagaggaagagtta
ccgcagacaaatcccggattcaataacactccttttaaattcaccaaatattcaaatgct
tatatgctggtgtatatacgtgaagctgacaaggaaaaagtaatatgcaatgtggacgag
aaagatattgctgagcatttaagggagaggttaaagaaagaacaggaagaaaaagagcac
aaaaagaaggaaaaggcagaggctcacctctacactattataaaggtggcacgggatgaa
gatcttggagaacagattggaaaggatatatattttgatcttgtagaacatgacaaagtg
cggagtttccgtgtacaaaagcagacaccatttaacgttttcaaggaagaggttgctaaa
gagttcggcatacctgttcaattccagcgcttttggctatgggcaaagcgtcaaaaccat
acatatcgtcctaatcgtccattgacacaaattgaggaagcacaatctgttggacaattg
agagagatatcgaacaaggttcacaatgcagaattaaaattgtttttggaagtggagcgt
ggaccggatttatgtcccattgcaccacctgagaagacaaaggatgatatattacttttt
ttcaagttatatgatcctgagaaagaggagctacgttttgttggcagactctttgtgaat
aacactggtaaaccatcagaaatcttagcaaggttaaataaaatggctggttatgatcct
gaagaagagattggactttatgaggaaattaagtttgaaccaaatgtgatgtgtgagcct
attgacaagaaattaacatttcgagcaagccagcttgaagatggagatattatatgcttt
cagaaggctcctgctacggataatgaggaacatatccgctatcctgatgtgccttcttac
ttggaatacgtgcacaatcgccaggttgttcactttcggtccctagataaaccaaaggaa
gatgacttctgcctggagatgtcaaggcttttcacatatgatgatgttgtggagagagta
gctgaacaacttggtttggacgacccatccaaaatcaggctcaccccacacaactgctat
tctcaacaaccaaaaccccagcctatcaagtaccgaggggtggaacatttatctgatatg
ctggttcactacaatcagacatccgacatattgtactatgaagtacttgacatccctctg
ccagaattacaaggtttgaaaactctgaaagttgcgtttcatcatgctaccaaggatgaa
gtggttatccacaccatcagactcccaaagcaaagcactgtaggagatgtccttgaggat
cttaaaaagaaggttgaattgtctcgtcctgatgctgaacttaggttgcttgaagtcttt
tatcacaagatatacaaggttttccctcccaatgaaaagattgaaaacataaatgaccaa
tactggacactacgagccgaggagataccagaagaagagaaaaatcttggtccccatgat
cgtctaatccacgtgtatcattttactaaagacactactcagaaccaaatgcaaattcag
aactttggggaaccttttttcttggtcatacacgaatgtgagactttggctgaaattaga
ttgcgaatacagaagaagcttcaagttccagacgatgagtttggcaagtggaagtttgct
tttttctcattagggcgtcctgagtaccttgaggactctgaagttgtatcaaatcgtttt
cagagaagagacgtatatggtgcttgggagcagtatcttggcttggagcatactgataat
gctccaaaaagatcatatgctgctaatcagaatcgtcacacatttgagaagccagtaaag
atttataattag

DBGET integrated database retrieval system