KEGG   Medicago truncatula (barrel medic): MTR_5g093300Help
Entry
MTR_5g093300      CDS       T01716                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_5g093300
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTR_5g093300
  Amino acid metabolism
   00310 Lysine degradation
    MTR_5g093300
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MTR_5g093300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 455 aa AA seqDB search
MFGVVRRRVAYGSTSSLLKIRSGTTRVSSVLEKEVALSSGGCGNIRNFCHITPGRWINSK
PIRDIFHQEASIQTWKRSFSSDNGDNVDVVVPPLAESIEDGTLAKFLKRPGDKVNVDEPI
AQIETDKVTIDVPSPESGVILKLLANEGDTVAPGNKIAIISRSADATTHVAPSETSPQKP
APKQTPKASEPEEKKAPKVETTTEKPKTPAPQSSPTEPQLPPKERERRVPMTRLRKRVAQ
RLKDSQNTFAMLTTFNEVDMTNLMKLRADYKDAFVEKHGVKLGLMSGFIKAAVNALQYQP
IVNAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRDADKMNFADIEKQINIFAKKANAGT
LSIDEMAGGTLTISNGGVYGSLLSTPIINPPQSAILGMHSIVSRPAVVGGNVVPRPLMYI
ALTYDHRIIDGREAVFFLRRIKDTVEDPRRLLLDI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgttgttagacgaagggttgcttatggaagcacatcttcgttgctgaaaatt
cggtccggcacaactagagtttcttctgttctcgaaaaagaggttgcattaagctcagga
ggatgtgggaatatccgaaatttctgtcatataacacctggacgctggattaattcaaaa
cctataagggacatttttcatcaagaggcttccattcaaacatggaagcgttcattttct
tcagataatggagataatgttgatgttgttgtccctccattggctgaatccatcgaggat
gggactctagcaaaatttctgaagaggcctggtgacaaggttaatgttgatgaaccaatt
gctcaaattgaaacagataaggtgacaatcgatgttccaagtcctgagtcaggtgtgatt
ctgaagcttctagccaatgaaggggatactgttgcaccaggtaacaaaatagcaatcatt
tcaaggtctgctgatgctacaacccacgttgcaccatctgagacttcacctcagaaacct
gctcctaagcaaaccccaaaggctagtgagccagaggagaagaaagctcctaaagttgaa
actacaacagagaagcctaaaacacctgctccacaaagctctccaactgagccacagctt
cctcctaaggaaagagaaagacgagttcctatgacaaggcttcggaaacgggttgctcaa
cggttgaaggattcccaaaacacatttgctatgctgacaaccttcaatgaagttgatatg
actaatttgatgaagctccgtgctgattataaggatgctttcgttgaaaagcatggagtc
aaattgggacttatgtctgggtttatcaaagctgctgtcaatgcacttcaatatcaaccg
attgtaaatgcggtcattgatggggatgatattatatacagagattatattgatatcagc
atagctgttggaactccgaagggacttgttgtgcctgttatccgtgatgcggataaaatg
aactttgcagatatagaaaaacagatcaatatttttgcaaagaaggctaatgctggaact
ttatcaattgatgagatggctggaggcactcttacaatatcaaatggtggtgtttatgga
agtcttttgagtacccctattatcaacccacctcagtcggcaatcttgggtatgcattcg
attgtgagccgtcccgcagttgttggtggaaatgttgttccaaggccattgatgtacatt
gctctaacatatgaccatagaatcattgatggaagagaggcagtgttctttttgagacgt
atcaaagataccgtggaggaccctcgcaggcttttgctcgacatataa

DBGET integrated database retrieval system