KEGG   Medicago truncatula (barrel medic): MTR_5g093570Help
Entry
MTR_5g093570      CDS       T01716                                 

Definition
Aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MTR_5g093570
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTR_5g093570
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MTR_5g093570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 384 aa AA seqDB search
MTATSMLFSCSMHVGVSNPMMASKSSACCLSNRPSSHSKSISSCGQFGVSGKSKLLCRAS
ALQVESAPSFSVGQKFQFDDVIEAQQFDRETLNAIFEVARSMENIRNNSSGSQMLKGYLM
ATLFYEPSTRTRLSFESAMRRLGGDVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVL
RHFESGAARRAATTASIPVINAGDGPGQHPTQALLDIYTIEREIGKLDGIKVGLVGDLAN
GRTVRSLAYLLAKYHDVKIYFVSPNVVKMKDDIKEYLTSEGVEWEESSDLMEVASKCDVV
YQTRIQKERFGDKINLYEEARGKYIVNQDVLKVMQNHAVVMHPLPRLDEIEVEVDSDPRA
AYFRQAKNGLYIRMALLKVLLLGW
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgactgctacttctatgttattctcgtgctctatgcatgtcggagtttctaatccaatg
atggcttcaaaatcatctgcgtgttgtttatcaaaccggccatcgagtcattcgaagtca
atttcatcatgtgggcagtttggagtttcgggaaaatcaaaacttttgtgccgggcaagt
gctcttcaagttgaaagtgctccttcattttctgttgggcaaaagtttcaatttgatgat
gtgattgaagctcaacaatttgatagagaaactctcaatgctatatttgaagttgcaagg
agtatggagaatattaggaacaactcatctgggagccaaatgcttaagggttacctcatg
gctactttgttttacgagccttccactagaaccaggctttcatttgagtctgccatgaga
agactaggtggtgatgttctcacaaccgaaaatgctagggagttttcgtctgcagctaaa
ggagagacgctcgaagatactataagaacagttgaaggttactctgatataattgtcttg
cggcactttgaaagtggcgcagcgagaagagctgcaacaactgctagcattccagtaatc
aatgcaggggatggcccgggacagcatcctactcaggcacttttagacatttataccatt
gaaagagagattggaaaactggacggaattaaagttgggcttgtcggagaccttgctaat
ggcagaacggttcgctcacttgcatacttacttgccaagtaccatgacgtgaaaatatat
ttcgtctctcctaatgtggtcaaaatgaaggatgacataaaagagtacctgacatcagaa
ggagtagagtgggaagaaagttctgatttgatggaagtggcttcaaagtgtgacgtagtt
tatcaaactcgcattcagaaggaaagatttggagacaaaattaacctttatgaagaggca
agaggcaagtatattgtaaatcaagatgttctaaaggtgatgcaaaatcatgctgttgta
atgcaccctcttccaagactcgacgaaatcgaagtggaagtcgatagtgatccaagagct
gcttactttaggcaagcgaaaaatggtctatatattaggatggctctattaaaggttttg
cttcttggttggtaa

DBGET integrated database retrieval system