KEGG   Medicago truncatula (barrel medic): MTR_6g012800Help
Entry
MTR_6g012800      CDS       T01716                                 

Definition
(RefSeq) pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00040  Pentose and glucuronate interconversions
mtr01100  Metabolic pathways
Module
mtr_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MTR_6g012800
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MTR_6g012800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase DUF4280
Motif
Other DBs
NCBI-GeneID: 11414917
NCBI-ProteinID: XP_003618540
UniProt: G7KKY7
Position
6
AA seq 316 aa AA seqDB search
MAPFVLTVSQNGTGNYRTVQEAIDAVPLRNTRRTIIRISPGIYRQPLYVAKTKNFITFVG
LCPEDTVLTWNNTANKIDHHQGSKVIGNGTFGCGSTIVEGEDFIAENITFENFSPEGSGQ
AVAVRVSGDRCAFYNCRFLGWQDTLYLHSGKQYLRDCYIEGSVDFIFGNSTALLEHCHIH
CKSAGFITAQSRKSPHEKTGYVFLRCAITGNGGSSYAYLGRPWGPFGRVVFAFTYMDNCI
KPAGWNNWGKVENEKSACFYEHRCFGPGFCPSKRVKWARVLKDKEAEEFLMHSFIDPEPQ
KPWLAQRMALRIPYSA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaccttttgtattgacagtgtcacaaaatggaacaggaaactacagaactgtacaa
gaagctattgatgcagtgccgctcagaaacacacgccggacgatcataaggatatcgccg
ggaatctaccggcaaccactttatgtggcaaagactaagaatttcatcactttcgttggt
ttgtgtcctgaagataccgttctcacatggaataacactgccaataaaattgatcaccac
caaggttcaaaggtgatagggaatgggacttttggttgtggaagcaccattgtggaaggg
gaagattttattgctgagaatattacttttgagaatttttctcctgagggttcagggcaa
gcagtggcagttagagtatcaggagatagatgtgcattttacaattgcaggttccttggg
tggcaggacacactttatttacattctggcaaacaatatttgagagattgttatattgaa
ggaagtgtggacttcatttttggtaatagcactgccctcttggagcattgtcatatccac
tgcaagtctgcagggttcataactgcacagagcagaaaatctccacatgaaaagactggt
tatgtatttttgagatgtgctatcacaggcaatggaggaagttcatatgcatatcttgga
aggccatggggaccttttggaagagtggtctttgcatttacttacatggataattgtata
aagcctgcaggttggaataattggggaaaagttgagaatgaaaaaagtgcttgcttctat
gaacacaggtgttttggaccgggtttttgtccctcaaaacgagtgaaatgggctagagta
ttgaaggataaagaagctgaggagtttctcatgcatagtttcattgatccagaaccacaa
aaaccttggcttgctcaaagaatggccttaaggattccatattctgcttag

DBGET integrated database retrieval system