KEGG   Medicago truncatula (barrel medic): MTR_6g029230Help
Entry
MTR_6g029230      CDS       T01716                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_6g029230
Messenger RNA biogenesis [BR:mtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     MTR_6g029230
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MTR_6g029230
Translation factors [BR:mtr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MTR_6g029230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 226 aa AA seqDB search
MDFTSSKNNNNASENNTENTHQIVDSSDSYNVKETEERQSRELKAGLHPLKSKFVFWYTR
RVPGIRNQSYEDNIKKIVEFSTVEGFWVCYCHLARPSSLPIPTDLHLFKEGIRPLWEDSA
NCNGGKWIIRFKKAVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDIVSVWNRNAS
DHQAVMALRDSIKRHLKLPHGYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggatttcacatcatccaagaacaacaacaacgcatcagaaaacaacaccgaaaacact
caccaaatcgtcgattcttctgattcttacaacgtcaaagaaaccgaagaacgacaatct
cgtgaactcaaagctggtcttcaccctcttaagagcaaatttgtgttttggtacactcgt
cgggtacctggaattcgaaaccaatcatacgaggataacattaagaagattgttgaattc
agtacggttgaaggattttgggtctgctattgccatcttgctcgtccttcttctttgcct
attccaacagatttgcatcttttcaaagaaggaattcgtcctttatgggaggactctgct
aactgcaatggtggaaaatggattatacgattcaaaaaggctgtctcaggtcgcttttgg
gaggatctggtgcttgccttggtgggtgaccaacttgattatggtgataacatttgtggt
gcagtactaagcattcgattcaacgaggacatagtgagtgtctggaatcgcaatgcctct
gatcatcaggctgtaatggctttgagagattcgatcaagcgtcacctaaagcttcctcac
ggctatgttatggagtacaaaccacatgatgcttctcttcgagacaattcatcttacagg
aacacttggttgagaggctag

DBGET integrated database retrieval system