KEGG   Medicago truncatula (barrel medic): MTR_6g029230Help
Entry
MTR_6g029230      CDS       T01716                                 

Definition
Eukaryotic translation initiation factor 4E type 3
Orthology
K03259  
translation initiation factor 4E
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mtr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 226 aa AA seqDB search
MDFTSSKNNNNASENNTENTHQIVDSSDSYNVKETEERQSRELKAGLHPLKSKFVFWYTR
RVPGIRNQSYEDNIKKIVEFSTVEGFWVCYCHLARPSSLPIPTDLHLFKEGIRPLWEDSA
NCNGGKWIIRFKKAVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDIVSVWNRNAS
DHQAVMALRDSIKRHLKLPHGYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggatttcacatcatccaagaacaacaacaacgcatcagaaaacaacaccgaaaacact
caccaaatcgtcgattcttctgattcttacaacgtcaaagaaaccgaagaacgacaatct
cgtgaactcaaagctggtcttcaccctcttaagagcaaatttgtgttttggtacactcgt
cgggtacctggaattcgaaaccaatcatacgaggataacattaagaagattgttgaattc
agtacggttgaaggattttgggtctgctattgccatcttgctcgtccttcttctttgcct
attccaacagatttgcatcttttcaaagaaggaattcgtcctttatgggaggactctgct
aactgcaatggtggaaaatggattatacgattcaaaaaggctgtctcaggtcgcttttgg
gaggatctggtgcttgccttggtgggtgaccaacttgattatggtgataacatttgtggt
gcagtactaagcattcgattcaacgaggacatagtgagtgtctggaatcgcaatgcctct
gatcatcaggctgtaatggctttgagagattcgatcaagcgtcacctaaagcttcctcac
ggctatgttatggagtacaaaccacatgatgcttctcttcgagacaattcatcttacagg
aacacttggttgagaggctag

DBGET integrated database retrieval system