KEGG   Medicago truncatula (barrel medic): MTR_6g069140Help
Entry
MTR_6g069140      CDS       T01716                                 

Definition
Alpha galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mtr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mtr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mtr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:mtr00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 420 aa AA seqDB search
MTLQYSSLGWSFKLSMMKGLVLCLLVLLNNANSSFARLLLNRTKEVSMFREQLKRTILDN
GVGQTPPMGWNSWNHFQCDISEALIKETADAMVSTGLADLGYQYINIDDCWAELNRDSKG
YMVAKSSTFPSGMKALADYVHSKGLKLGIYSDAGNQTCSKRMPGSLGHEEQDAKTFASWG
IDYLKYDNCENNDVTPKERYPRMGEALVQSGRPIFYSLCEWGAEDPSIWGKSVGNSWRTT
SDIEDKWDSMISCADQNNKWASYAGPGGWNDPDMLEVGNGGMTTEEYRAHFSIWALVKAP
LLIGCDIRALDDITKELLRNSEVIAVNQDKLGIQGKKVKSNDDLEVWAGPLSDNRLAVVL
WNRSSSKAIVTASWSDLGLKPGTSIDARDLWEHSTQSKVSGDISAELDSHACKMYILTPN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacacttcaatattcaagcttaggttggagcttcaagttatcgatgatgaaagggctt
gttttgtgtctccttgtgctattgaataatgcaaattcttcatttgctcgtttgttattg
aatagaaccaaagaagtgtccatgtttagagagcaacttaaaagaaccatccttgataat
ggagttggccagacaccccctatgggatggaatagctggaaccattttcaatgtgatatt
agcgaagccttaatcaaagaaacagctgatgctatggtgtcgactggccttgctgatcta
ggttaccaatatattaatatagatgattgttgggctgaacttaatagagactcaaagggt
tatatggttgccaaatcatcaacattcccttcaggaatgaaggctctagctgattatgta
catagcaaaggtctaaagctagggatctattctgatgcaggaaatcaaacatgcagtaaa
agaatgccaggatcattagggcatgaagaacaagatgcaaaaacatttgcttcatgggga
attgactacttgaagtatgataattgtgagaataatgatgtaacccccaaagaaaggtac
ccacgaatgggtgaagctttagtacaatctggaaggccaatcttctactctttgtgtgaa
tggggagcagaagacccgtcaatatgggggaagagtgtgggaaatagttggagaacaaca
tcagatatcgaagataaatgggatagtatgatatcttgcgcagatcaaaataataaatgg
gcttcttacgctggacctggaggatggaatgatcctgacatgcttgaagttggaaatgga
ggtatgacaacagaagaatatcgtgcccatttcagcatatgggcattagttaaggcccct
ttattgatcggttgtgacattcgagcactggatgacatcacaaaggaactgctaagaaac
tcagaagttatagcagtaaatcaagacaaattaggaattcaagggaagaaggtgaaaagt
aatgatgatttggaggtttgggcaggtcctctcagtgataacaggctagcggtcgtctta
tggaatagaagttcatcgaaagcaatagtaactgcatcttggtctgacctaggtctaaaa
ccaggaacttcaattgatgcaagagatttatgggagcattcaacacaatcaaaagtgtcg
ggagatatatctgctgaattagattcacatgcttgtaagatgtatatcctgactcccaac
taa

DBGET integrated database retrieval system