KEGG   Medicago truncatula (barrel medic): MTR_6g069630Help
Entry
MTR_6g069630      CDS       T01716                                 

Definition
Aldose 1-epimerase family protein expressed
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_6g069630
   00052 Galactose metabolism
    MTR_6g069630
Enzymes [BR:mtr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MTR_6g069630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 339 aa AA seqDB search
MADQNKKPEIFELNNGTMQLLVTNLGCTITSFSVPAKDGVLSDVVLGLDSVESYQKGLAP
YFGCIVGRVANRIKNGKFTLDGVEYSLPLNKAPNTLHGGNVGFDKKVWDVLEYKKGETPS
ITFKYDSHDGEEGYPGDITVTATYTLTSSTTMRLDMEGVAKNKPTIINLAQHTYWNLAGH
SSGNILDHSIKISANHVTPVDQNTVPTGEIVPVKGTPFDFTSEKRIGDTINQVGLGYDHN
YVLDCGEEKAGLRHAAKVRDPSSSRVLNLWTNAPGVQFYTGNYVDNVTGKGGAVYGKHAG
LCLETQGFPDAVNKPNFPSVVVKPGEKYQHSMLFEFSIE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcagaacaaaaaacctgagatctttgaactcaacaatggcaccatgcagctc
cttgttaccaatcttggttgcactatcacctccttctctgttcctgccaaagatggtgtg
ttatccgatgttgttcttggccttgactctgttgaatcctatcagaaaggtctagctcct
tattttggctgcattgtgggtcgggttgcaaaccggattaagaatggaaagtttacactt
gatggggttgagtactcgttgcctctcaacaaagccccaaacactctccacggtggaaat
gttgggtttgataagaaggtatgggatgtacttgaatataaaaaaggcgaaactccatca
attacttttaagtatgacagtcatgatggagaggaaggttatcctggcgacatcactgtc
actgcaacttacacgctcacctcaagcacgactatgaggctcgacatggaaggagtggca
aagaacaagccaaccatcattaacttagctcagcatacctattggaacttagctggccat
agctcagggaatattctcgatcattcaattaagatatcggctaatcatgtcactcctgtt
gatcagaacaccgtgccaaccggtgaaattgtgcccgtgaagggtactccttttgatttc
acatctgagaaaagaataggtgataccattaatcaagttggtttaggatatgaccacaat
tacgtgcttgactgtggcgaagagaaagccggtttgaggcatgctgcaaaagttagggat
ccatcaagttcaagggtacttaacttgtggacaaatgcacctggggtgcaattttatact
ggaaattacgtcgacaatgtaaccggcaaaggaggagctgtatatggaaagcatgccgga
ttatgtctcgaaacacaaggattccctgatgcagtaaacaaaccgaattttccatccgtt
gttgttaaacctggcgagaagtatcagcattctatgttgtttgagttttcgattgaataa

DBGET integrated database retrieval system