KEGG   Medicago truncatula (barrel medic): MTR_6g087000Help
Entry
MTR_6g087000      CDS       T01716                                 

Definition
Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     MTR_6g087000
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   MTR_6g087000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 559 aa AA seqDB search
MWCTVHSSWSSFSGAEYNKPLQASVRAVTNGTLWTLKREDFRGILVSEFSNLSSLKLLRS
VDLLSRLSILQLSQISDSLSEVTFSSGQTIINKVSYLASVLLCFCSPFFSKFFGMFLQNE
VLALYIIQKGRVKLTFDADLLTSPNTYSLKADIENEDDDVQSGTELSIEKPEGSYFGEWS
LLDQQIGSLTAVAEDDVVCALLTKDKLESVIGSLQKISQEDHKLRDNSEEFTKSFEFSSF
DKVQLSDLEWRKTIYSTDCSEIGLANLKDSENVLTLKKFSKPKVKRLGKESQVLKEKDLI
KSMSSSACVPQVLCTFADRIYAGILLNTRLACPLSSILSSPFSESAARYCAASVVIALED
LHKNGVLYRGVSHDVLMLDQRGHIQLVDFRFGKKLSDERTFTICGRADSLAPEIVLGKGH
SFPADWWALGVLVYFMLCGEMPFGSWRENELDTVAKIAKRKLNLPETFSPDAVDLISKLL
DVEENTRLGSQGSDSVKSHSWFNGIDWEALRHHAFPVPPEIVSRITQYLEVRYEDSSASV
ESPLEEVEELNVPEWLEDW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgtacggtacattcaagctggagttctttttcaggcgcggagtacaacaaacca
ctccaagcctctgtgcgtgctgtaacaaacggaactctttggactttaaagcgagaagat
tttcgcgggattttagtgtcagaattctctaacttatcatcattgaagttacttcggtcc
gtagatctcctctccagattgtcaattttacaactgagtcagatctctgactccctttct
gaagttaccttctcaagtggacagacaataatcaataaagtaagctatctagcttcagta
cttttgtgcttttgttctccattcttttctaagttctttggcatgtttttgcagaatgaa
gtccttgcattgtacatcatccaaaagggacgtgtaaaattaactttcgatgctgattta
ttgacaagtccaaatacctacagcctcaaggccgacatcgaaaatgaggacgatgatgta
cagagcggaacagaactgtcaatagagaagcctgagggaagctatttcggtgaatggtcc
cttcttgatcaacaaattggttccttaactgctgttgctgaggatgatgttgtatgtgct
ttactaacaaaggacaaacttgaatcagttattggctccttgcaaaagatttctcaggaa
gatcacaagttgagggataattccgaggaattcactaaaagttttgaattctcatcgttt
gataaagtccagctctcagatttggagtggagaaagacgatatattccactgactgctct
gagattggacttgcaaatttaaaagactcagaaaatgtgcttactttgaagaaattttcc
aagccgaaagtgaaaaggctaggaaaggaatcacaagtcttgaaagagaaagatttgatt
aagagtatgagctcttcagcttgtgtaccacaagttttatgcacctttgccgaccgcata
tatgctggaatactgctaaatacacgtcttgcttgccctttgtcttccatactatcaagt
ccttttagcgaatcagcggcccgatattgtgctgcttctgttgtgattgccttagaagac
ttgcacaagaatggtgttctgtatagaggtgtctcgcatgatgttttgatgttggatcaa
agaggacatatacagctggtggacttcagatttggaaagaagctctctgatgagagaaca
ttcacaatttgtgggagggcagattcactagctccagagattgttctcggaaaaggccac
agtttccctgccgactggtgggcattgggagttttggtatattttatgttatgcggcgag
atgccatttggatcatggagagaaaatgaactcgatacagttgccaaaattgcaaaacgg
aaactaaatcttcctgaaacttttagccctgacgctgttgatctcatctccaagttactt
gacgtggaagaaaatactagacttggtagccaaggttctgattctgtcaagagtcactca
tggtttaacggtatcgactgggaagcacttagacaccacgcttttcctgttcctccagaa
attgtttctcgtataacacaatacttggaagttcgttatgaggattcttccgcttctgtt
gagtctccattagaagaggtagaagaacttaatgtgcctgaatggcttgaagattggtag

DBGET integrated database retrieval system