KEGG   Medicago truncatula (barrel medic): MTR_6g087000Help
Entry
MTR_6g087000      CDS       T01716                                 

Definition
(RefSeq) cyclic nucleotide-binding domain protein
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1072 aa AA seqDB search
MGCIYSRVCIGETCKGSSINGDPISRHELQQAFSPSSDGGEIRDQLNQLSLTRDPEAGIR
RLARVSSQFLPPDGSRIAKVDSEKYELRYSYLSQRGYYPDALDKANQDSFCIHTPFGTDV
NDHFFGVFDGHGEFGAECSQFVKRRLCENLLRNSKFNVDPVEACHASFLATNSQLHADVL
DDSMSGTTAITILVRGKTVYVANCGDSRAVIAEKKGKDGDIVAVDLSIDQTPYRVDELER
VKLCGARVLTLDQIEGLKNPEVPCWGSDEEGDDGDPPRLWVPNGMYPGTAFTRSIGDSIA
ETIGVVANPEIVSFELTPNNPFFVIASDGVFEFLSSQTVVDMVAKFKDPRDACAAIVAES
YRLWLQYETRTDDITVIIVHINGLKEPNVAHSESYREVLRTPVPQVVEVTGSESPSTFGW
NARNHRVRQELSRARLRAIENSLENGQGWVPPSSAHRKTWEEEAHIEQALNDHFLFRKLT
ESQCHVLLDCMQRVNVEPGDIIVKQGGESDCFYVVGSGEFEVLATQEEKDGEVPRVLQRY
TAEKLSCFGELALMYNKPLQASVRAVTNGTLWTLKREDFRGILVSEFSNLSSLKLLRSVD
LLSRLSILQLSQISDSLSEVTFSSGQTIINKNEVLALYIIQKGRVKLTFDADLLTSPNTY
SLKADIENEDDDVQSGTELSIEKPEGSYFGEWSLLDQQIGSLTAVAEDDVVCALLTKDKL
ESVIGSLQKISQEDHKLRDNSEEFTKSFEFSSFDKVQLSDLEWRKTIYSTDCSEIGLANL
KDSENVLTLKKFSKPKVKRLGKESQVLKEKDLIKSMSSSACVPQVLCTFADRIYAGILLN
TRLACPLSSILSSPFSESAARYCAASVVIALEDLHKNGVLYRGVSHDVLMLDQRGHIQLV
DFRFGKKLSDERTFTICGRADSLAPEIVLGKGHSFPADWWALGVLVYFMLCGEMPFGSWR
ENELDTVAKIAKRKLNLPETFSPDAVDLISKLLDVEENTRLGSQGSDSVKSHSWFNGIDW
EALRHHAFPVPPEIVSRITQYLEVRYEDSSASVESPLEEVEELNVPEWLEDW
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgggatgcatttattcaagagtatgcataggtgaaacatgtaaaggttcaagcatcaat
ggtgacccaatttcaagacatgagcttcaacaagctttttcaccatcctctgatggtggt
gaaattcgagaccaattgaatcagttaagcttaactagagatcctgaagctggaataaga
agactagctagggtttcgtcgcagtttcttccaccggatggttcgaggattgcgaaggtt
gattcggagaagtatgaattacggtattcgtatctttctcagcgcggttattatcctgat
gctcttgataaagcgaatcaagatagtttttgtattcacacgccatttggaacggatgtg
aatgatcattttttcggtgtttttgatggtcatggtgaatttggggcggagtgttcacag
tttgtgaagcgtaggctttgtgagaatttgttaaggaattctaagtttaatgttgatcct
gttgaggcttgtcatgcgtcttttttagctacgaattcacagttacatgctgatgtttta
gatgatagtatgagtggaacaacagccataacaattttggttagagggaagacggtttat
gtagcgaattgtggtgattcgagggcggtgatagcggagaagaaagggaaagatggtgat
attgttgcagttgatttgtctattgatcagacaccttatagagttgatgagttagaaaga
gtgaaactttgtggtgctagggttctaactttggatcaaattgaagggttaaagaatcct
gaagttccgtgttggggtagtgatgaagaaggtgatgatggcgatcctcctaggttgtgg
gtcccaaatgggatgtaccctggtactgcttttacaaggagtattggtgattctattgcc
gagactattggtgttgttgcgaatcctgagattgttagttttgaactcacacctaacaat
ccattttttgttattgctagtgatggtgtttttgagtttctttctagccaaactgtggtt
gatatggttgcaaaattcaaagatccacgtgatgcttgtgctgcgatagtggcagaatct
tatcgactatggctacagtatgagactcgtacagatgatattacagtcatcattgtgcat
ataaatggactaaaagaacccaatgttgctcactcggaaagttatcgcgaagttttacga
acccctgtccctcaagttgtagaggtgacaggttcagaatctccttccacatttggatgg
aatgctaggaatcatcgtgtaaggcaagaattgtcaagggcacgcctccgagcaattgaa
aattccctcgagaatggacaaggttgggttcctccatcttcagcccacagaaagacatgg
gaggaagaagcacacatagaacaggcgttgaatgaccattttctctttcgaaaacttacc
gaatctcagtgtcatgttttattggattgcatgcaaagagttaacgtcgaacctggggat
attatagtcaaacagggtggtgaaagtgactgtttttatgtcgttggcagcggagaattt
gaagtcttggcaactcaggaagaaaaagatggggaggtacctagggttttgcagcgctac
acagctgaaaaactatcatgctttggagaacttgctctgatgtacaacaaaccactccaa
gcctctgtgcgtgctgtaacaaacggaactctttggactttaaagcgagaagattttcgc
gggattttagtgtcagaattctctaacttatcatcattgaagttacttcggtccgtagat
ctcctctccagattgtcaattttacaactgagtcagatctctgactccctttctgaagtt
accttctcaagtggacagacaataatcaataaaaatgaagtccttgcattgtacatcatc
caaaagggacgtgtaaaattaactttcgatgctgatttattgacaagtccaaatacctac
agcctcaaggccgacatcgaaaatgaggacgatgatgtacagagcggaacagaactgtca
atagagaagcctgagggaagctatttcggtgaatggtcccttcttgatcaacaaattggt
tccttaactgctgttgctgaggatgatgttgtatgtgctttactaacaaaggacaaactt
gaatcagttattggctccttgcaaaagatttctcaggaagatcacaagttgagggataat
tccgaggaattcactaaaagttttgaattctcatcgtttgataaagtccagctctcagat
ttggagtggagaaagacgatatattccactgactgctctgagattggacttgcaaattta
aaagactcagaaaatgtgcttactttgaagaaattttccaagccgaaagtgaaaaggcta
ggaaaggaatcacaagtcttgaaagagaaagatttgattaagagtatgagctcttcagct
tgtgtaccacaagttttatgcacctttgccgaccgcatatatgctggaatactgctaaat
acacgtcttgcttgccctttgtcttccatactatcaagtccttttagcgaatcagcggcc
cgatattgtgctgcttctgttgtgattgccttagaagacttgcacaagaatggtgttctg
tatagaggtgtctcgcatgatgttttgatgttggatcaaagaggacatatacagctggtg
gacttcagatttggaaagaagctctctgatgagagaacattcacaatttgtgggagggca
gattcactagctccagagattgttctcggaaaaggccacagtttccctgccgactggtgg
gcattgggagttttggtatattttatgttatgcggcgagatgccatttggatcatggaga
gaaaatgaactcgatacagttgccaaaattgcaaaacggaaactaaatcttcctgaaact
tttagccctgacgctgttgatctcatctccaagttacttgacgtggaagaaaatactaga
cttggtagccaaggttctgattctgtcaagagtcactcatggtttaacggtatcgactgg
gaagcacttagacaccacgcttttcctgttcctccagaaattgtttctcgtataacacaa
tacttggaagttcgttatgaggattcttccgcttctgttgagtctccattagaagaggta
gaagaacttaatgtgcctgaatggcttgaagattggtag

DBGET integrated database retrieval system