KEGG   Medicago truncatula (barrel medic): MTR_6g090470Help
Entry
MTR_6g090470      CDS       T01716                                 

Definition
MAP kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    MTR_6g090470
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MTR_6g090470
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MTR_6g090470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 415 aa AA seqDB search
MVKFHDSMHDQGVAEEGLVEALNALRLFLLLLVFMKLTCVEIVIRTASGTFHDGDLMLNQ
KGMRLISEEKESRTDSQTGLTILSRTLSFLRHQSCMTNSQTSSGWSFLRHQSCMKNLQTS
SAEIEANRLKRHSLKSRAEFISAVSKFHSPTSGHTASACAQPSDAKDLDFDFTLDDLETV
KVIGKGSGGVVQLVRHKWVGKLFALKAIPMNIQEDIRKQIVQELKINQASQCPHVVVCYH
SFYNNGVISLVLEYMDRGSLVDVIRQVNTILEPYLAVVCKQVLQGLVYLHNERHVIHRDI
KPSNLLVNHKGEVKITDFGVSAMLASTMGQRDTFVGTYNYMSPERISGSTYDYSCDIWSL
GMVVLECAIGRFPYIQSEDQQAWPSFYELLQAIVESPPPSAPPDQFSPEFCSFVS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagttccatgattctatgcatgatcaaggtgtcgcggaagagggtttggttgag
gctttgaatgctttgaggctatttcttcttcttcttgtgtttatgaaattgacttgtgtt
gaaattgttattaggactgcaagtggtacatttcatgatggagatctgatgttgaaccag
aaagggatgcgtcttatttctgaagaaaaggaatcaaggactgatagccaaactggtcta
acaatattgtcgcgcactttgtcatttctccgacaccaaagctgcatgacaaactcgcag
acaagtagcggttggtcatttctccgacaccaaagctgcatgaaaaacttgcagacaagt
agcgctgaaatagaggccaatagattaaagagacactccttaaagtctcgtgcagaattt
atctcggctgtcagcaagttccatagtcctacttctggccatactgcttcagcctgtgca
cagccttcggatgctaaggatctcgactttgacttcacattggacgaccttgagactgtc
aaagtaatcggaaaaggcagcggtggcgtagtgcaacttgttcgccataagtgggtcgga
aaattgtttgctttaaaggccattccaatgaatatacaagaggatattcggaaacagatt
gttcaggaattgaaaataaaccaagcatcacagtgtccacatgttgtagtttgctatcac
tcattctataacaatggagttatatctcttgtattagaatacatggaccgtggttctctc
gtagatgtaatcagacaagttaatacaattctggaaccatatcttgctgtggtttgtaaa
caggttttacagggccttgtttatttgcacaatgaaagacatgtcatacatagggacatc
aaaccatccaatcttttagtaaaccacaaaggggaggtgaagattactgattttggcgtc
agtgctatgctggcaagcacaatgggccaaagagatacatttgttggaacttataattac
atgtcgccagaaagaatcagtggcagtacttatgattatagctgtgacatctggagtttg
gggatggtagtactcgaatgtgccatagggcggtttccttatatacaatctgaagatcag
caagcatggcctagtttctatgagcttttgcaagcaattgtcgaaagtccaccaccttct
gctcctcctgaccagttctcgccggagttttgttcatttgtgtcg

DBGET integrated database retrieval system