KEGG   Medicago truncatula (barrel medic): MTR_7g031310Help
Entry
MTR_7g031310      CDS       T01716                                 

Definition
Protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTR_7g031310
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MTR_7g031310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 499 aa AA seqDB search
MASSAKDDNPRSVKRVAVVGAGVSGLAAAYKLKSHGLDVTVFEAEGRAGGRLRTVSRDGL
VWDEGANTMTENEIEVKGLIDALGLHEKQQYPLSQHKRYIVKNGTPVLVPANPAALLKSK
LLSAQSKIQVIFEPFMWKRSDSSAVRDENSEESVSRFFERHFGKEVVDYLIDPFVGGTSA
AGPESLSIRHSFPELWNLEKRFGSIIAGALQSSVFGKKDKAGETKDVPRKNKHQRGSFSF
QGGMQTLTDTLCKELGKDDIKLNAKVLTLAYSHDGSSPSQNWSITCTSNRKAQDVDAVIM
TAPLGNVRDIQIKKKGNPFPLNFLPEVTYLPLSVLITTFKKENVKRPLEGFGVLVPSKEQ
QNGFKTLGTLFSSMMFPDRAPSDMHLYTTFIGGTRNRELAQASTDELTKIVTSDLRKLLG
AEGEPAFVNHFFWSKGFPLYGHNYGSVLEAIDKMEKDLPGFFYAGNHRGGLSVGRAIASG
CKAADLVISYLNNASDNSV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctgcaaaagatgataatccaagatctgttaaaagagttgctgttgttggt
gctggtgtaagtgggcttgctgcggcttacaaattgaaatcacatggtctagatgtaact
gtatttgaagctgaaggaagagctggagggaggctaagaactgtttctcgagatgggcta
gtttgggacgagggagctaatacaatgactgaaaatgaaatagaggttaaaggtttgatt
gatgctcttggacttcatgaaaaacaacaatatccattgtcacagcataagcgctatatt
gtgaaaaatgggacaccagttctggtacccgcaaatcctgctgcactactgaagagcaaa
cttctttctgcacaatcaaagattcaggtcattttcgaaccgtttatgtggaaaagaagt
gactcatctgccgtgcgtgatgaaaattccgaagaaagtgttagtagattcttcgaacgc
cattttgggaaagaggtcgtggactacctcattgatccttttgttggaggtacaagtgca
gcaggccctgagtctctttctatccgccattctttcccagagctatggaatttggagaaa
aggtttggttccattatagcaggggctttacaatccagcgtatttggaaaaaaggacaaa
gctggagaaactaaagatgtaccaagaaaaaacaagcaccagcgtggttcattttctttt
cagggtgggatgcagacactgactgatacattgtgcaaagagcttggcaaagatgacatt
aaattaaatgcgaaggttctgacactagcttacagtcatgatggaagttccccatcgcaa
aactggtctattacttgtacttctaaccgaaaagcacaagatgttgatgccgtaattatg
acggctcctcttggtaacgtcagagacatccagatcaagaaaaagggaaaccccttccca
cttaattttcttcctgaggtgacctatttaccactctcagtcttaataaccacctttaaa
aaggagaatgtaaagagacctctggagggatttggagttcttgttccttcaaaagagcaa
caaaatggttttaaaaccctaggtacacttttttcttctatgatgtttccagatcgagca
cccagtgatatgcatctctataccaccttcataggaggaacacgaaacagggaacttgct
caagcttcaactgacgagcttacgaaaattgtcacttctgacctgagaaagctgttggga
gcagagggggagcctgcattcgtcaaccatttcttctggagtaaaggctttcctttatat
ggtcataactatgggtcagttcttgaagcaattgacaaaatggaaaaagatctccctgga
tttttctatgctggtaatcacagagggggactctcagttggtagagcaattgcctcgggt
tgcaaagcagctgatcttgtaatctcctacctcaacaatgcttcagacaacagtgtctga

DBGET integrated database retrieval system