KEGG   Medicago truncatula (barrel medic): MTR_7g031310Help
Entry
MTR_7g031310      CDS       T01716                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00860  Porphyrin and chlorophyll metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Module
mtr_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTR_7g031310
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MTR_7g031310
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     MTR_7g031310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO FAD_oxidored Pyr_redox_2 Pyr_redox HI0933_like Thi4 FMO-like AlaDh_PNT_C FAD_binding_3 GIDA IlvN NAD_binding_9 Prenylcys_lyase Pyr_redox_3 3HCDH_N ApbA NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 11437846
NCBI-ProteinID: XP_003622202
UniProt: G7L3C0
Position
7
AA seq 499 aa AA seqDB search
MASSAKDDNPRSVKRVAVVGAGVSGLAAAYKLKSHGLDVTVFEAEGRAGGRLRTVSRDGL
VWDEGANTMTENEIEVKGLIDALGLHEKQQYPLSQHKRYIVKNGTPVLVPANPAALLKSK
LLSAQSKIQVIFEPFMWKRSDSSAVRDENSEESVSRFFERHFGKEVVDYLIDPFVGGTSA
AGPESLSIRHSFPELWNLEKRFGSIIAGALQSSVFGKKDKAGETKDVPRKNKHQRGSFSF
QGGMQTLTDTLCKELGKDDIKLNAKVLTLAYSHDGSSPSQNWSITCTSNRKAQDVDAVIM
TAPLGNVRDIQIKKKGNPFPLNFLPEVTYLPLSVLITTFKKENVKRPLEGFGVLVPSKEQ
QNGFKTLGTLFSSMMFPDRAPSDMHLYTTFIGGTRNRELAQASTDELTKIVTSDLRKLLG
AEGEPAFVNHFFWSKGFPLYGHNYGSVLEAIDKMEKDLPGFFYAGNHRGGLSVGRAIASG
CKAADLVISYLNNASDNSV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctgcaaaagatgataatccaagatctgttaaaagagttgctgttgttggt
gctggtgtaagtgggcttgctgcggcttacaaattgaaatcacatggtctagatgtaact
gtatttgaagctgaaggaagagctggagggaggctaagaactgtttctcgagatgggcta
gtttgggacgagggagctaatacaatgactgaaaatgaaatagaggttaaaggtttgatt
gatgctcttggacttcatgaaaaacaacaatatccattgtcacagcataagcgctatatt
gtgaaaaatgggacaccagttctggtacccgcaaatcctgctgcactactgaagagcaaa
cttctttctgcacaatcaaagattcaggtcattttcgaaccgtttatgtggaaaagaagt
gactcatctgccgtgcgtgatgaaaattccgaagaaagtgttagtagattcttcgaacgc
cattttgggaaagaggtcgtggactacctcattgatccttttgttggaggtacaagtgca
gcaggccctgagtctctttctatccgccattctttcccagagctatggaatttggagaaa
aggtttggttccattatagcaggggctttacaatccagcgtatttggaaaaaaggacaaa
gctggagaaactaaagatgtaccaagaaaaaacaagcaccagcgtggttcattttctttt
cagggtgggatgcagacactgactgatacattgtgcaaagagcttggcaaagatgacatt
aaattaaatgcgaaggttctgacactagcttacagtcatgatggaagttccccatcgcaa
aactggtctattacttgtacttctaaccgaaaagcacaagatgttgatgccgtaattatg
acggctcctcttggtaacgtcagagacatccagatcaagaaaaagggaaaccccttccca
cttaattttcttcctgaggtgacctatttaccactctcagtcttaataaccacctttaaa
aaggagaatgtaaagagacctctggagggatttggagttcttgttccttcaaaagagcaa
caaaatggttttaaaaccctaggtacacttttttcttctatgatgtttccagatcgagca
cccagtgatatgcatctctataccaccttcataggaggaacacgaaacagggaacttgct
caagcttcaactgacgagcttacgaaaattgtcacttctgacctgagaaagctgttggga
gcagagggggagcctgcattcgtcaaccatttcttctggagtaaaggctttcctttatat
ggtcataactatgggtcagttcttgaagcaattgacaaaatggaaaaagatctccctgga
tttttctatgctggtaatcacagagggggactctcagttggtagagcaattgcctcgggt
tgcaaagcagctgatcttgtaatctcctacctcaacaatgcttcagacaacagtgtctga

DBGET integrated database retrieval system