KEGG   Medicago truncatula (barrel medic): MTR_7g038400Help
Entry
MTR_7g038400      CDS       T01716                                 

Definition
3-methyl-2-oxobutanoate hydroxymethyltransferase
Orthology
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MTR_7g038400
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     MTR_7g038400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 351 aa AA seqDB search
MAILRSILKATKTTLQHSSSLLRNMSNLPENTVYTGPTPQNKRVTLSQLHQKHKNSQPIT
MVTAYDYPSAVHLDMAAIDICLVGDSASMVVHGHDTTLPITLDEMLVHCRAVARGAKTPL
LVGDLPFGTYECSSNQAVDTAVRILKEGQMDAIKLEGGSPSRIVAAKAIVEAGIAVIGHV
GLTPQAISVLGGFRPQGRNVASAVKVVETALALQEAGCFAVVLECVPAPVAAAATAALQI
PTIGIGAGPYCSGQVLVYHDLLGMLQHPHHAKVTPKFCKQYARVGDVINKALLEYKEDVM
NGSFPDAQHSPYKISETDANGFLNELQKLGFDKAASAASEAVQKMVSKSTK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcaattctaagatcaatactgaaagcaacaaaaacaacccttcaacattcatcatct
cttctccgtaacatgagcaatctcccagaaaacacagtatacacaggtccaacaccacaa
aacaaaagagtaacactttcacaactacatcaaaaacataaaaactcacaaccaatcaca
atggtcactgcttatgattacccttctgctgttcacctcgatatggccgccattgatatc
tgtcttgttggtgattctgcttccatggttgttcatggtcatgatactactttgcctatt
actttagatgaaatgcttgttcattgtcgtgctgttgctcgtggtgctaaaactcctctt
cttgttggtgatttgccttttggaacctatgaatgtagttctaatcaggcagtggacacg
gcagttcgaattttgaaagaaggacaaatggatgccataaagttggaaggaggttcacct
tcaagaattgttgcagcaaaagctattgttgaagctggaatagctgtgattgggcatgtt
ggtcttactccacaagccattagtgttttaggaggatttaggcctcagggaaggaatgtt
gcaagtgctgtcaaggttgtcgagacagcattggctttgcaagaagcagggtgttttgct
gttgttcttgaatgtgtgcctgcaccggtggctgcagcagcaacagcggcgcttcaaatt
cctacaattggaattggggctggtccctattgcagtggacaggtgcttgtttaccatgat
cttcttggtatgttacaacaccctcaccatgcaaaggtgactccaaaattttgtaaacag
tacgctcgtgttggagacgtcatcaataaagccttactggaatataaggaagatgtgatg
aatggttcatttcctgatgctcaacatagtccatacaaaatcagtgaaactgatgctaat
ggtttcttaaatgagctgcaaaagttaggttttgacaaggctgcatctgcggcatctgaa
gcagttcagaagatggtttcaaaatcaacaaagtaa

DBGET integrated database retrieval system