KEGG   Medicago truncatula (barrel medic): MTR_7g055700Help
Entry
MTR_7g055700      CDS       T01716                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTR_7g055700
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MTR_7g055700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 456 aa AA seqDB search
MGCLDDGRFNVELENGKNNGKDGSAIEDAVKVLLMGLGEDINREGIRKTPLRVAKALRDG
TRGYRQKVKDIVEGALFPEAGLDNRVGHAGGAGGLVIVRDIDLFSYCESCMLPFQVKCHV
GYVPSSERVVGLSKLSRVADVFAKRLQEPQRLANEVCSALHHGIKPDGVAIILQCTHIHF
PDVESVFLDSNHQGLVKILVSAGSGVFENKNADEWADFFSLLKFRGISMEKINFRGSSDM
SWCSSQSAKISSKVGPVNPAMVTAAASIIKSLGEDPLRKELRGTPTRFVKWLMNFQNCNF
DMKLNGFLNGGIASLDTNKEVELNDKKICSELNLAFWSQCEHHLLPFHGVVHIGYILSDG
FSPIGKSLLQSIVHFYGFKLQVQERLTRQIAETISPLIGGDVIVVVEASHTCMISRGIEK
FGSSTATIAVLGQFSTDLTTRASFLQGIPSPTSSDQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtttagatgatggtcgattcaatgttgagcttgaaaatgggaagaacaatggg
aaagatggttctgccattgaagatgctgtcaaggttttgttgatgggtcttggtgaagat
attaatagggaaggtattagaaagacaccacttcgtgttgccaaagcccttcgtgatgga
acaagaggttacaggcaaaaggtgaaggacattgttgaaggtgctttattccctgaagct
ggtttagataatagagttggccatgctggtggagcaggtggacttgtgattgttagagat
attgacttgttttcctattgcgagtcatgcatgcttccattccaggtcaagtgtcatgtc
ggttacgttccctccagtgaaagagttgttggtttaagcaaactctcccgtgttgctgat
gtatttgcaaagcggcttcaagagcctcagcgtcttgcaaatgaagtttgttctgctctg
catcatggaataaagccagatggtgttgccatcatacttcaatgtacacacatccacttt
ccagacgtagaatcagtctttctcgactcaaaccaccaaggattggttaagatactcgtt
tccgctggttctggggttttcgaaaacaagaacgcagacgaatgggctgatttctttagt
ctcctcaaatttagaggtatcagtatggaaaaaatcaattttagaggatcatctgacatg
agctggtgttcttctcaatcagccaaaatttcctccaaagtcgggcctgtcaaccctgca
atggtcactgcagcagcttcgattattaaatctttgggagaagatccactgaggaaggag
cttagagggactccaactagatttgtgaagtggttgatgaattttcaaaactgcaacttt
gacatgaagttgaatggttttctcaatggtgggatagcttctttagacacaaataaggag
gttgaattgaatgacaagaaaatatgttctgagctgaacttagcattttggtcacaatgt
gagcaccatttacttccatttcatggtgttgttcacataggttacatcctatcagatgga
tttagtcctattggaaaatctcttttacaatcgatagtgcatttttacggtttcaagctt
caagttcaggagaggcttaccagacagatagctgaaacaatttcgccgttgataggtggc
gatgtgatagtagttgtagaggctagtcacacatgtatgatttctaggggtattgaaaag
tttggaagtagtactgcgactattgctgttttaggacagttttcaactgaccttacgaca
agggcttccttcttgcagggtattccaagtcctacatcttcagatcaatga

DBGET integrated database retrieval system