KEGG   Medicago truncatula (barrel medic): MTR_7g068320Help
Entry
MTR_7g068320      CDS       T01716                                 

Definition
Alcohol dehydrogenase-like protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:mtr01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtr00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mtr00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mtr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 393 aa AA seqDB search
MATSEVANGNHLSGTKGKTITCKAAVAHGPGEPFVVEQILVQPPQKMEVRIKILYTSICH
TDLSGWKGECEPQRAYPRIFGHEASGIVESVGEGVNDMKENDKVVLIFNGECGECKCCMC
KKTNMCEKSGVDPMKKLMCDGTSRFSSIDGKPIFHFLNTSTFTEYTVVDSACAVKLNTED
NLSLKKLTLLSCGVSTGIGAAWNNANVHAGSSVAIFGLGAVGLAVAEGARARGASKIIGV
DINPDKFNNTAETMGITEFINPKDEEKPVYEIIREMTDGGVDYSFECTGNLNVLRDSFLS
VHEGWGLTVLLGIHGSPKLLPIHPMELFDGRRIEGSVFGGFKGKSQLPNLATECMKGAIK
LDNFITHELPFDEINQAFNLLIAGKSLRCVLTL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttcagaagttgcaaatggcaaccacttaagtgggacaaagggaaagaccatt
acttgtaaagctgctgtggcacatggtccaggagaaccctttgtagtggaacaaattctt
gtacaacctcctcagaaaatggaggttagaatcaagatcctatatacttccatttgtcac
actgatctcagtggttggaaaggagagtgtgagcctcaacgtgcttatcctcggattttt
ggccatgaagcttccgggattgtggaaagtgtaggggaaggagtgaatgacatgaaagaa
aatgacaaagtggtgctaatattcaatggtgagtgtggtgagtgtaagtgctgcatgtgc
aagaaaaccaacatgtgtgagaaatctggagtagacccaatgaagaagttaatgtgtgat
ggaacaagtagattttcttcaatagatggcaaacccatttttcatttcttgaatacttca
actttcactgagtatacagtggtggattcagcttgtgctgttaagctcaacactgaagat
aaccttagtctcaaaaaactcaccttgcttagttgtggagtttccacaggaataggagct
gcttggaataatgctaatgtgcatgctggttcatctgtagcaatctttggtttaggtgca
gttggcctcgctgttgcagaaggggcacgagcaagaggtgcatcaaaaataataggtgtg
gatattaacccagacaaattcaataacacagccgaaacaatgggaatcacagaattcata
aatccaaaggatgaagaaaagccagtatacgagataatcagagaaatgactgatggaggt
gtagactatagttttgaatgtaccggaaatttgaacgttctaagagatagcttcttatct
gttcatgagggttggggattgactgtactattgggaattcatggatcaccaaagttgctt
cccatccacccaatggagctctttgatggtcgcagaatcgaaggttcagtgttcggaggt
ttcaaaggcaaaagtcaattgcctaatcttgccacagaatgcatgaaaggggcgataaag
ttggataatttcatcactcacgagcttccctttgatgagataaaccaagccttcaatctt
ttgattgccgggaagtcattgagatgtgttcttacactctaa

DBGET integrated database retrieval system