KEGG   Medicago truncatula (barrel medic): MTR_7g072330Help
Entry
MTR_7g072330      CDS       T01716                                 

Definition
(RefSeq) regulatory-associated protein of TOR protein
  KO
K07204  
regulatory associated protein of mTOR
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1369 aa AA seqDB search
MALGDLMASRFSQSTVLIVPNHHRDDSTSTTAFSASASSASAAALNDDGSDFNSSVPNRR
DSEFGAASSSSAGVYGNAATTMVYLPQTSFFNELRHDAFELELPTGPSDSGLVSKWRPKD
RMKTGCVALVLCLNINVDPPDVIKISPCARMECWIDPFSMAPQKALELIGKSLTSQYERW
QPKARYKCQLDPTLDEVKKLCTTCRRYAKSERVLFHYNGHGVPKPTHNGELWVFNKSYTQ
YIPLPLNDLDSWLKTPSIYVFDCSAAGKVVNAFIQLHEWNASNSDGSPRDCIMLAACEAH
ETLPQSVEFPADVFTACLTTPIKMALRWFSTRSLLRDSFDYLLIDKIPGRPNDRKTLLGE
LNWIFTAVTDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCTPVSHPMLP
PTHQHHMWDAWDMAAELCLSQLPSLVEDPNAEFQPSTFFTEQLTAFEVWLDHGSEHKKPP
EQLPIVLQVLLSQCHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTTTPELRQI
LVFIWTKILALDKSCQVDLVKDGGHIYFMKFLDSSEAYPEQRAMAAFVLAVIVDGHRRGQ
EACIEAGLSHVCLKHLESSSPNDSQTEPLFLQWLCLCLGKLWEEFPEGKIIGLQGHATSI
LAPLLSEPQPEVRASAVFALGTLVDVGFDSCRSVGDEECDDDDKFRAEVSIVRSLLSVAS
DGSPLVRAEVAVALARFAFGHNKHLKSIAAAYWKPQTNSLINSLPSLTNIKDTGGGYSKQ
NQHMAHGSIVSPQIGPLRVGSDNSKVIRDGRVSSSSPLASSGIMHGSPLSDNSSHHSDSG
ILNDGFSNGVVNSFGPKPLDNALYSQCVLAMCTLAKDPSPRVGNLGRRVLSIIGIEQVVA
KPLKPSGVRTSSVVPVSASLARSSSWFDMNGGHLPLTFRTPPVSPPRPSYIAGMRRVCSL
EFRPHLMTSPDTGLADPLLGSGTFDRSLLPQSSIYNWSCGHFSKSLLTAADDSEEVLARR
EEREKFALEHIVKCQHSAVSRLTNPIAKWDIKGTQTLLLQPFSPIVVAADENERIRVWNH
EEATLLNSFDNHDFPDKGISKLCLVNELDDSLLLAASSDGNVRVWKDYSLRGKQKLVTAF
SSIHGHKPGVRSPNAVVDWQQQCGYLYASGETSLIMMWDLDKEQLVNTIPSSSECSVSAL
AASQVHGGQFAAGFVDGSVRLYDARTPEMLVCGLRPHTQRVEKVMGIGFQPGLDPGKLVS
ASQAGDIQFLDIRNHSSAYLTIEAHRGSLTALAVHRHAPIIASGSAKQLIKVFSLEGDQL
GTIRYYPTLMAQKIGSVSCLSFHPYQLLLAAGAADACVCIYADDNTQAK
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atggcattgggagatttaatggcatcgcgattttcccaatcaactgttcttatagttcct
aatcatcaccgcgacgattccacctccacaaccgctttttccgcctccgcatcttcagct
tccgccgccgccttaaatgatgatggctccgatttcaatagttctgttccgaaccggcgt
gattcggaattcggagctgcgagtagtagtagcgcaggtgtttatggtaatgctgctact
acgatggtgtatttgccgcagacgagtttcttcaatgagcttcgtcatgatgcgtttgag
cttgagctgcctactggtccatcggatagtggtttggtctcgaaatggaggccgaaggat
aggatgaagacaggatgtgtagctctagtattatgtttaaatattaatgtcgatccacca
gatgtaataaagatatctccttgtgccagaatggagtgctggatagatcctttttctatg
gcaccacagaaggcattagagttgattgggaaatctttgaccagtcagtatgaaagatgg
caaccaaaggcacgctataagtgtcaacttgatccaacactggatgaggtgaaaaagctt
tgtactacatgtcgtagatatgcaaagtcggaaagagttttgttccattacaatgggcat
ggtgtgccaaagccaactcataatggggaactttgggtcttcaataagagctatacacag
tatatccccttaccactcaatgatcttgattcctggcttaagaccccatcaatttatgtt
tttgattgctctgcggctggtaaagttgtgaatgccttcattcagcttcatgaatggaat
gcttctaactccgatgggtcaccaagggattgcattatgcttgcagcatgtgaagcgcac
gagactttgccccagagtgtagaattcccagctgatgtatttacagcttgtcttacaaca
cctataaagatggcattgcgatggttttctactcgttcgttacttcgcgactcgtttgat
tatttacttatagacaagatccctggtcgtccaaatgaccgaaagactcttcttggtgaa
ttgaattggatctttacagcagtaactgatacaattgcatggaatgttcttcctcatgat
ctttttcagagactgttcagacaggatttgcttgttgcaagtttgtttcgaaattttcta
cttgcggagcgaattatgcgatcggcaaattgtactcccgtttctcaccctatgctacca
ccaacccatcagcatcatatgtgggatgcgtgggatatggctgccgagctctgcctttct
caacttccttcattagttgaggatcctaatgcagaatttcagcctagtacattttttact
gagcagttaacagcatttgaagtttggctcgaccatggttctgagcataagaaaccaccc
gaacagttgcctatagttcttcaggttttacttagtcaatgccatcgatttcgtgccttg
gtactcctaggaagatttcttgatatgggcccatgggctgtggatctggcattatctgtt
ggaatcttcccttatgttctgaagctgttgcaaacaaccacaccagaactaagacagatt
cttgtattcatatggacaaagatccttgcacttgacaagtcatgtcaggttgatctagtg
aaggacggaggtcatatctattttatgaagtttcttgatagctcggaagcgtacccagag
caacgtgcaatggctgcttttgttttggctgtgattgtggatggtcatagaagaggccaa
gaagcttgtattgaagctggtttgagccatgtctgcttaaagcaccttgagagttcatct
cctaatgattcacaaacggagccccttttccttcaatggctttgcctgtgtctggggaaa
ttgtgggaagagtttccagaggggaaaataatcggtttgcagggacatgcaacttctata
cttgctcctctactgtctgaaccccagccagaggtcagagcatctgctgtttttgcactg
ggtacccttgttgatgtgggatttgattcgtgtagaagtgttggagatgaagaatgtgat
gatgatgacaagtttagggctgaagttagtatagttaggagtctgttgagtgttgcttca
gatgggagtccattggtgagggcggaggtagcagtggcgctagcacgctttgcttttggc
cacaacaagcacctgaaatctattgctgctgcatattggaaacctcagactaattctttg
ataaattccttaccatcattgactaatattaaagatacgggtggtggatattctaaacag
aaccaacatatggctcatgggagtattgtttcacctcaaattggtcctctaagggttggg
agtgacaattctaaagtaattcgtgatgggcgggtctcttcaagcagtcctctcgctagt
tctggaataatgcacgggtccccattgtctgacaattcctctcatcattctgattcagga
atactgaatgatggtttcagcaatggagtggttaacagctttgggccaaagcctttggac
aatgcattatattcacaatgtgtacttgctatgtgtactttggcaaaagatccatctccg
cgagttgggaaccttggtcgtcgggtactgtccataataggcattgaacaagtggttgca
aaaccattgaagccttctggtgttcggactagtagtgtagttcccgtttctgctagtctt
gctcgctcgtcttcttggtttgatatgaatggtggacacttgcctctaaccttcagaact
cctccagtcagtcctcctcgtccaagttacatagctggaatgcggagagtatgttcattg
gagtttaggcctcacctgatgacttctccagacactggactagctgacccacttttagga
tcggggactttcgatcgcagtttacttcctcaatcaagtatatataattggagttgtggg
cacttctccaaatcacttttaactgctgcagatgatagcgaagaagttttagctagaagg
gaggagagggaaaaatttgcattggagcacatagtgaaatgccagcactctgctgttagt
aggttaacaaatccaattgctaaatgggacataaagggcacacaaacattgttgctacaa
cctttctctcctatagtggttgctgctgacgagaatgaacgtatcagggtatggaaccac
gaagaggcaacactacttaatagttttgataatcacgattttcctgacaaaggaatttct
aagctctgcctggtgaatgagcttgatgatagcttgcttcttgctgcttcatctgatgga
aacgttcgggtttggaaagactattccctgagggggaaacagaagcttgtcactgcattc
tcttcaattcatgggcataaacctggtgtgaggagtccgaatgcagttgttgattggcag
cagcaatgcggctatctgtatgcgtcgggggagacgtcattaataatgatgtgggatctt
gataaagagcagcttgttaatactataccttcatcatcagagtgcagtgtctctgcgttg
gctgcttctcaagttcacgggggacagttcgcagctggttttgtagatggttctgtaaga
ctctacgatgccagaacacctgaaatgcttgtatgtggattacggccacacacacagaga
gtagaaaaagttatgggaattggctttcaacctgggttagaccctggaaagttggttagt
gcttctcaggccggggatatccaattccttgatataagaaatcatagcagcgcctatctc
actattgaagctcaccggggctcactcacagctttagcagtacatagacatgctccaatt
attgccagtggttctgccaaacaactcattaaggttttcagccttgagggtgatcaactg
ggcaccattcgttactatcctactctaatggcccagaaaattggttccgtgagctgctta
agtttccacccatatcaattactacttgctgctggtgctgcagatgcatgtgtgtgcatc
tatgccgatgacaacactcaagcaaaatga

DBGET integrated database retrieval system