KEGG   Medicago truncatula (barrel medic): MTR_7g081620Help
Entry
MTR_7g081620      CDS       T01716                                 

Definition
Lipase
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTR_7g081620
   00592 alpha-Linolenic acid metabolism
    MTR_7g081620
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     MTR_7g081620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 450 aa AA seqDB search
MTSLNHTTSHISFPKTTTFTIKPQCITLQPLKPNTKQHSYETLKTTHKIPNLSSSKSTFS
PLPFPTTKVNKRWKEYQGMTNWEGLLDPLDNNLRSEILRYGHFVEAAYKSFEFDPSSSNY
ATNKFPKTTLFKKCGLPKTGYKVTKHLHATSGIQLPSWIDKAPSWVATKSSYIGYVAVCD
NKEEIKRLGRRDVVIALRGTTTCLEWLENLRATLTNINPLECDNSSQHSINSDENDQPMV
ESGFLSLYTSKSNSTNNEAIPSLQEMVRSEIERILKTYKGENLSFTITGHSLGAALAILT
AHDIKTYFDQKPLVTVISFGGPRVGNKSFRLKLEKEGIKVLRIVNSDDVITKMPGFVLDD
KVEESVYDMEGNNDDMAWFLPRWIQKRVKETQWVYSEVGEELRVCSRNSPYLKGVNIATC
HDLKTYLHLVDGFVSSECPFRSTARRFLQL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacatccttaaaccacactacatcccacatttctttccccaaaaccacaaccttcact
atcaaaccacaatgcataacacttcaaccactcaaacccaacacaaaacaacactcctac
gaaaccttaaaaaccacacacaaaataccaaacctttcatcatcaaaatcaacattttca
ccattaccatttccaactacaaaagttaacaaaagatggaaagaataccaaggtatgacc
aattgggaaggtttattagacccattagacaataatcttcgttccgaaatccttcgttat
ggccattttgttgaagctgcatataaatcctttgaattcgacccttcttcatcaaactat
gccacaaacaagttccccaaaaccacactcttcaaaaaatgtggtttacccaaaaccggt
tacaaagtaacaaaacatttacatgctacctcaggaattcaactacctagttggatagac
aaagcaccatcatgggttgcaacaaaatcaagctacattggttatgtagctgtttgtgac
aacaaagaagaaattaaacggcttggtcgaagagacgttgttattgcattaagaggaaca
actacttgtttagaatggctcgaaaatcttcgtgccactctaaccaacattaatccattg
gaatgcgataattcttcgcaacattcaatcaactccgatgaaaatgatcaaccaatggtg
gaaagtgggtttttgagtctctacacttcaaaatcaaattctacaaataatgaagcaatt
ccctcattgcaagaaatggtgagaagtgaaattgaacgcattctaaaaacatataaaggt
gaaaatttgagttttactataacaggacacagtttaggagcagcattagcaattttaacc
gcgcatgatataaaaacatattttgatcagaaaccgttagtaacggtaatctcattcggc
ggtccacgtgttggtaacaagagtttccggttaaaactcgaaaaagaaggaatcaaagtg
ttgcgtatagtaaactcagacgacgtaatcacgaaaatgccagggtttgttttagacgat
aaagttgaagaaagtgtttatgacatggaagggaataacgatgacatggcatggtttttg
ccacgatggatacaaaagagagtgaaggaaacgcagtgggtttactcagaggtgggggag
gagttaagggtatgtagcaggaattcaccatacttaaaaggtgttaatattgccacgtgt
catgatttgaagacatatttgcatcttgttgacggctttgtcagctctgaatgtcctttt
agatctactgccaggaggttccttcagctgtaa

DBGET integrated database retrieval system