KEGG   Medicago truncatula (barrel medic): MTR_7g084090Help
Entry
MTR_7g084090      CDS       T01716                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, suvh protein
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MTR_7g084090
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MTR_7g084090
Chromosome [BR:mtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MTR_7g084090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 757 aa AA seqDB search
MVAQSLEIRDSVANDCVVPKLLKVSMTPKVKIKVKYGGKKLRDESKDATTTEVTPMSLQR
RSSSRIQAKQKEVEEIQLRRKAEGVEAEEKSDEVEVSPVKSRKRVRRSPSRESVVKEVVE
EKETTEKKKEDVVVEGKPTKKRKSASDEKRELMEVWNEKMAAETENAGGALSDKSSTAKV
KETIRTFNKHYLHLVQEEEARVAKDNAEIEKRGGGKKSASKKKSPKKSPEKKSPKKSPGK
KSTKKDAEPKEKQHSAKRPDLKAITKMMQNKEILYPDKRIGSIPGIEVGYQFYSRAEMVA
VGFHSHWLNGIDFIGQSYSKTYPKLKLPVAVAIVISGMYEDDLDNAEDVVYTGQGGHNLT
GNKRQIQDQKLERGNLALKNCWDQKVPVRVIRGHDSRSSYTRKVYTYDGLYKVDRYWAEK
GISGFTVYKFRLRRVEGQPTLTTNQVYFTMGRVPQSTAEIRGLICDDITNGQEAVPIPAT
NLVDDPPVPPPPGFTYLKSLKVAKGVKIPESASGCKCKDKCTDPNTCECAKRNGSEFPYV
SKDGGRLIEAKDVVFECGPNCGCGPECVNRTSQRGLHYRLEVFRTAKKGWAVRSWDFIPS
GAPVCEYTGILGRTEDVDSVLENNYIFEIDCLQTIKGLGQRERRSKNVAYASSLLEKYDD
QDSESAPEFCIDAGSTGNVARFINHCCEPNLFVQCVLSTHHDLRLARVVLFAADNIPPLQ
ELTYDYGYALDSVLDSDGKVKQMACYCGATGCRKRLF
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggtggctcaatcgttggagattcgcgattccgttgcgaatgattgtgttgttccgaag
cttttgaaggtttcaatgactcctaaggtgaagattaaggtgaaatacggtggaaagaag
ctgagagatgaatctaaggatgctacgacgacggaggtgacaccaatgtcgttgcaacgg
agatcgagttcgaggattcaagctaagcagaaagaggttgaagagattcagcttcgccgg
aaagctgagggggtagaagctgaagagaaatccgacgaggttgaggtttcaccggtgaag
tcgaggaagcgtgtgaggagaagtcctagtagggagagtgtggttaaggaggttgttgag
gagaaagagacgacggagaagaagaaggaagatgttgttgttgagggaaaaccgacgaag
aagaggaaatctgcgtcggatgaaaaacgtgagctgatggaggtttggaatgagaaaatg
gctgctgaaactgaaaatgctggcggtgcattgagtgataagagctcaacggcgaaggtg
aaggagactattaggacttttaacaagcactatcttcatttggttcaggaggaggaggcg
agggttgctaaagataacgctgaaattgagaagagaggtggtggaaagaaatctgcttct
aaaaagaaatctcctaaaaaatctcctgagaagaaatctcctaaaaaatctcctgggaag
aagtccactaagaaagatgcagaacctaaagaaaaacaacactctgccaagcgacctgat
ctgaaagccataaccaagatgatgcaaaataaggagatactgtaccctgacaaaagaatt
ggcagcattccaggcattgaggttggatatcagttctattctcgtgctgaaatggttgca
gttggttttcatagccactggttaaatggcattgattttatcggccaatcttattccaaa
acgtaccccaagctcaaactcccagttgctgtggcaattgttatttcaggcatgtatgaa
gatgatctggataatgctgaggatgttgtgtacactggtcaaggtgggcataatttgacc
ggtaataagcgtcaaattcaagatcaaaagttggagcggggtaatttagcactcaagaac
tgctgggatcaaaaggtgccagtaagggtgattcgaggtcatgactcacgtagcagttac
actcgtaaagtctatacatatgatggcttgtacaaggttgaccgctattgggcagagaag
ggaatatctggcttcacagtatacaagtttcgtctcaggagggttgaaggacagcctact
ttaacaacaaatcaggtttatttcacaatgggacgtgtacctcagtctacagcagaaata
cgagggttgatatgtgatgatatcactaacggtcaggaagctgtgcccattccagctaca
aatttggttgatgacccacctgttccgccgcccccaggtttcacatatttgaagtctctg
aaggttgcaaaaggcgtaaaaattcctgagagcgcctctggatgcaaatgcaaagacaaa
tgtactgatccaaacacctgtgaatgtgcaaagcgcaatggctctgaatttccctatgta
tctaaagatggtggcagattaattgaagctaaagacgttgtgtttgaatgtggtcccaat
tgtggctgtggtcctgagtgtgtgaataggacttctcaaagaggacttcactatcgtctg
gaggttttccgtactgcaaagaaaggatgggctgttagatcctgggattttataccttct
ggtgcaccggtttgtgagtacactggaatacttggtaggactgaagacgtagacagtgta
ttggaaaacaactatatttttgagatagattgcttgcaaacaatcaaggggcttggtcaa
agggagaggcggtcaaaaaatgtagcatatgcttcaagtttgctggaaaaatacgatgac
caagattctgaaagtgcaccagagttttgcattgatgcagggtctactggaaatgttgct
aggtttataaaccattgttgtgagcctaatttgtttgtacaatgtgttttgagcacacac
catgatttgcgattggctcgagtggtgctgtttgccgctgacaacataccccctttacag
gagctgacatatgactatggctatgcgcttgatagcgtcctggactctgatgggaaggta
aagcaaatggcgtgctattgtggagctacaggctgcaggaagcgattattctaa

DBGET integrated database retrieval system