KEGG   Medicago truncatula (barrel medic): MTR_7g084850Help
Entry
MTR_7g084850      CDS       T01716                                 

Definition
Acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_7g084850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_7g084850
   00620 Pyruvate metabolism
    MTR_7g084850
   00640 Propanoate metabolism
    MTR_7g084850
Enzymes [BR:mtr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MTR_7g084850
Lipid biosynthesis proteins [BR:mtr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MTR_7g084850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 748 aa AA seqDB search
MLSSQGVLDPILCVTQKNKNKNPFCSSSVSSLFCNNINSSSRRRRNHKNLMSTNHRTNNY
LRHLESMKILPSGAGRIPRLNAVILGESLATEENDFVVPSQDFANQANVKSPEQYLKMYK
RSIEDPAGFWSEIASEFYWKQKWGDQVCHENFDVRKGNVNIEWFKGGITNICYNCLDRNV
EAGLGDKVAFYWEGNELGVDATLTYTQLLHQVCQVANYLKDIGVKKGDAVIIYLPMLMEL
PITMLACARIGAVHSVVFAGFSSESLSQRIIDCKPKVVITCNAVKRGSKVIYLKDIVDTA
INDSTQNGVSIDVCVTYDNKLALKREETKWTKGRDIWWQDVIPHCPTTCPVEWLDAEDPL
FLLYTSGSTGKPKGVVHTTGGYMVYTATTFKYAFDYKPSDIYWCTADCGWITGHSYVTYG
PILNGATVVLYEGAPNYPDAGRSWNIVDKYKVSIFYTAPTLVRSLMRDGDEHVTRYSRKS
LRVLGSVGEPINPSAWRWFYNVIGDSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATC
PFFGVQPVIVDENGVEIEGECSGYLCIKKSWPGAFRTLYGDHERYETTYFKPFAGYYFSG
DGCSRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALVSHPKCAEAAVVGVEHEVKGQSI
YAFVTLVDGVPYSEELRKDLVLTVRKQIGAFAAPDKIHWAPGLPKTRSGKIMRRILRKIA
SRQLDELGDTSTLAEPNVVTELIELADS
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgttatcatcacaaggtgtattggatccaattctgtgtgtaactcagaagaacaagaac
aagaaccctttttgttcttcctctgtttcttctctgttctgcaacaacatcaatagtagc
agtagaagaagaaggaatcataagaatttgatgtctacgaatcacagaacaaataattac
ttacgccatttagaatcaatgaagattcttccatctggtgctggtcgcattcctcgtttg
aatgctgttattcttggtgaatctcttgctactgaagaaaatgattttgttgttccaagc
caagattttgctaatcaagcaaatgttaaatctccagaacagtatttgaagatgtataag
agatccattgaggatcctgctggattttggtctgaaattgcatcagaattctattggaaa
caaaaatggggtgatcaagtttgtcatgagaattttgatgttagaaaaggaaatgttaac
attgagtggtttaagggtgggatcaccaacatttgttataattgtttggatagaaatgtt
gaagctggactaggtgacaaagtggccttttattgggaagggaatgaacttggtgttgat
gctactttaacatacactcagcttctacatcaagtttgccaggttgcaaactacctgaaa
gatattggtgtgaaaaagggagatgctgtgattatttatttgcccatgcttatggagctt
cctatcacaatgcttgcttgtgcccgcattggtgctgttcattcggttgtatttgcaggg
ttttcttcagaatctctttcgcagagaatcattgattgtaagccaaaagttgtaattact
tgcaatgctgttaaaaggggctctaaagttatctatctgaaagacatagttgatactgcc
atcaatgattcaactcaaaatggggtttctatagatgtatgcgtaacttatgacaacaaa
ttagcattgaagagggaggaaactaaatggacgaaagggcgagatatatggtggcaggat
gttattcctcactgtccaactacttgtccagtggagtggcttgatgcagaggatccactt
tttctactctatactagtggaagtaccggaaaacctaagggcgtcgtccataccactggt
ggttatatggtatacactgcaacaacatttaagtatgcatttgactacaagccatctgac
atctactggtgtacagctgattgtggttggattaccgggcacagctatgtcacttatgga
cccatactcaatggtgcaactgttgttctgtatgaaggggctcccaattatcctgatgct
gggcgtagttggaacattgttgacaaatataaagtatcaatattctacactgctcctaca
ttggtgcggtccctcatgcgtgatggtgacgagcatgttacccgctactcgaggaaatct
ttacgagtcttgggaagtgtaggggagcctataaatccaagtgcatggagatggttttac
aatgtaattggagattcaagatgccctatctctgacacttggtggcaaacagaaactggt
ggtttcatgataactccactgcctggtgcttggccccagaaacctggttctgctacttgc
cctttctttggagttcagcctgtaatagtggatgagaatggtgttgagatcgaaggtgag
tgcagtggttatttgtgtattaagaaatcatggccaggggcattcagaactttgtatggt
gatcatgaacgatacgaaacaacatatttcaagccctttgctggctactatttcagtggt
gatggctgtagcagggataaagatggatactattggcttaccggaagagttgacgatgtc
atcaatgtcagtgggcatcgtattggcacagctgaagtggaatcagctctagtttcacac
ccaaaatgtgccgaagcagccgttgtaggcgtggagcacgaggttaaaggacagagtata
tatgcctttgttactcttgtggatggtgttccatacagtgaagaactgcggaaggacctt
gtactcacagttcgaaagcagataggagcctttgcagcacctgacaaaatccattgggca
cctggcctcccaaaaacaaggagcggaaagataatgagaagaattcttagaaaaattgct
tctaggcagctagatgaacttggagatacaagtacccttgcagagccaaacgtggtcact
gaacttattgaacttgctgattcatga

DBGET integrated database retrieval system