KEGG   Medicago truncatula (barrel medic): MTR_7g088370Help
Entry
MTR_7g088370      CDS       T01716                                 

Definition
Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MTR_7g088370
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MTR_7g088370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 705 aa AA seqDB search
MDHNLGQESVPADKSRVLNVKPLRTLVPVFPSPSNPSSSSNPQGGAPFVAVSPAGPFPAG
VAPFYPFFVSPESQRLSEQHAPNPTPQRATPISAAVPINSFKTPTAATNGDVGSSRRKSR
TRRGQLTEEEGYDNTEVIDVDAETGGGSSKRKKRAKGRRASGAATDGSGVAAVDVDLDAV
AHDILQSINPMVFDVINHPDGSRDSVTYTLMIYEVLRRKLGQIEESTKDLHTGAKRPDLK
AGNVMMTKGVRSNSKKRIGIVPGVEIGDIFFFRFEMCLVGLHSPSMAGIDYLTSKASQEE
EPLAVSIVSSGGYEDDTGDGDVLIYSGQGGVNREKGASDQKLERGNLALEKSMHRGNDVR
VIRGLKDVMHPSGKVYVYDGIYKIQDSWVEKAKSGFNVFKYKLARVRGQPEAYTIWKSIQ
QWTDKAAPRTGVILPDLTSGAEKVPVCLVNDVDNEKGPAYFTYIPTLKNLRGVAPVESSF
GCSCIGGCQPGNRNCPCIQKNGGYLPYTAAGLVADLKSVIHECGPSCQCPPTCRNRISQA
GLKFRLEVFRTSNKGWGLRSWDAIRAGTFICEYAGEVIDNARAEMLGAENEDEYIFDSTR
IYQQLEVFPANIEAPKIPSPLYITAKNEGNVARFMNHSCSPNVLWRPIVRENKNEPDLHI
AFFAIRHIPPMMELTYDYGINLPLQAGQRKKNCLCGSVKCRGYFC
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggatcataatttgggtcaagaatctgttcctgctgataagtccagggttttaaatgtt
aagccattgaggactcttgttccggtgttcccttcaccgtctaacccttcatcgtcttca
aatccacaaggtggtgctccttttgttgctgtttctcctgctggtcctttccctgctggt
gttgcacccttttaccctttctttgtttcaccggagtctcagaggctttctgaacaacat
gcaccaaacccaactcctcaacgtgccacaccaatatctgctgcagttccaattaactca
ttcaagactccaactgcggcgacaaatggagatgttggctcgtcacggaggaaaagccgg
actcgtcgtggacagcttaccgaggaagaaggctacgataatactgaggtaattgatgta
gatgctgaaactgggggtgggagttcaaagcgcaagaagagggcaaagggacgacgagct
agtggtgctgctaccgatgggagtggtgtggctgccgttgatgttgatctagatgcggtt
gctcatgatattctccaatcaatcaaccccatggtttttgatgtaataaatcatcctgat
ggtagtagggactcggtgacatatacacttatgatatacgaagtgctccgaagaaagctt
ggacaaattgaagagtcaacaaaggaccttcatactggagcaaagcgacctgatttgaag
gcaggcaatgttatgatgactaaaggggttaggagtaacagcaagaaaaggattggaatc
gtgcctggtgttgaaattggagatattttctttttccgatttgagatgtgcttagtggga
ttacattcaccttctatggctggaattgattacctgacttccaaagcaagtcaagaggaa
gagccattagctgttagtattgtctcctctggaggatatgaagatgatacaggcgatggg
gatgtgttgatttatagtggccaaggtggagttaaccgtgaaaagggagcaagtgatcaa
aagcttgaaaggggtaatcttgctttggaaaagagtatgcatagaggtaacgatgtgaga
gtcattaggggtttgaaggatgtaatgcatccatctgggaaggtatatgtctatgatgga
atttacaagattcaagattcatgggtggagaaagcaaaatctggattcaatgtattcaag
tataaattagcgagggtgcgtgggcagcctgaagcatatacgatatggaaatccattcaa
caatggaccgataaggcggctccaagaacaggggttatattgcccgatcttacttccggg
gctgaaaaagtccctgtttgtcttgttaacgatgttgataacgagaagggccctgcatat
ttcacttacatccccactctcaagaatttgaggggagttgctcctgtggaatcttcattt
ggttgttcttgtattggtgggtgtcaacctggcaatcgtaactgtccttgcattcaaaag
aatggaggttaccttccatatactgcagctgggttagttgcggacctaaaatccgtgata
catgagtgtggtccttcttgtcagtgccctcctacttgccgaaatcggatttcccaagct
ggcctaaaatttcgtttggaggtgtttagaactagtaacaaaggttggggcctaagatcg
tgggatgctattcgtgctggtacttttatatgtgagtatgcaggggaagtcatagataat
gctagagccgagatgcttggtgctgaaaacgaagacgaatacatttttgattctactcgc
atctatcagcagctggaagtttttcctgctaatattgaagctccaaagatcccatctccg
ctttatatcacagcaaagaatgaagggaatgttgctcggtttatgaatcatagctgctct
ccaaatgtgttgtggcgtccgattgtacgtgaaaataagaatgaaccggatctccacatt
gctttctttgcaattagacacatccctcctatgatggagctaacttatgattatgggata
aatcttcctctccaagcaggtcaaaggaaaaagaattgcttatgcggatctgtgaaatgc
agaggttacttttgttaa

DBGET integrated database retrieval system