KEGG   Medicago truncatula (barrel medic): MTR_7g088740Help
Entry
MTR_7g088740      CDS       T01716                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTR_7g088740
Enzymes [BR:mtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MTR_7g088740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1022 aa AA seqDB search
MVNPGLVSGNKPVNSVKISFRLPYLTQWGQSLLVCGSVPVLGSWNVKKGVLLSPFHEGSE
LIWSGSITVPKGFQCEYTYYVVDDKKNIVRWEMGKKHELALPDGVQSGQEIEFRDLWQTG
SDALPFRSAFRDVIFRKSWDSSVKTTTGANHINLEPEAESILIQFKVFCPNIEKDTSIYV
IGSNTKLGQWKVENGLKLSYVGEFVWLAECVIQRTLQSSLTIISTYRYCKYGRSGNASIE
NGPNREVSISASRREAKYIFLSDGMIRETPWRGAGVAIPMFSIRSESDLGVGEFLDLKLL
VDWAVASGFHLVQLLPINDTSVHQMWWDSYPYRYSSTFKIIAVLISNTHPSPLFLSLSVF
ALHPLYLRVQALSENIPEEIKQEIEKAKQQLDGKEVDYEAAVATKLSIAKKVFNQEKDLI
LNSSSFQQFFSENEGWLKPYAAFCFLRDFFETSERSQWGRFAQYSEDKLEKLVSTESLHY
EIICFHYYVQYHLHLQLSEASEYARKKGVILKGDLPIGVDRNSVDTWVYPNLFRMNTSTG
APPDYFDKNGQNWGFPTYNWEEMSKDNYGWWRARLTQMGKYFTAYRIDHILGFFRIWELP
DHAVTGLVGKFRPSIPLSQEELEKEGIWDFNRLSRPYIRQEILQEKFGSAWAFIATAFLN
EYDKNCYEFKEDSNTEKKIVSKLKTSGESSLLLESEDKMRRNLIDLLQNIVLIRDPENPK
DFYPRFNLEDTSSFQALDDHSKNVLKRLYYDYYFHRQENLWRQNALKTLPALLNSSEMLA
CGEDLGLIPSCVHPVCQLYSLSSNKQEPPSHSCVMQELGLVGLRIQRMPNESDLEFGIPS
QYSYMTVCAPSCHDCSTLRAWWEEDEERRQRFFKNVMESDELPPDQCVPEVAHFIIRQHI
ESPSMWAIFPLQDLLALKEEYTARPAIEETINDPTNPKHYWRYRVHVTLESLNKDNELKT
IIKDLVRWGGRSVPLEDSQAEANLISTSSVADTVSEKQQFAGTGEKIRHPSEYNGIPSLT
AR
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatccgggattggtttctggaaataagccggtgaattcagtcaagataagcttt
cggttaccttatcttactcaatggggtcagagtttgctggtgtgtggctctgtaccagtg
cttggatcttggaatgtgaagaagggtgtgttgcttagtccctttcatgaaggttctgag
ctcatttggagtggaagcattactgtgccaaaagggttccaatgtgagtacacctattat
gttgtggatgataagaaaaatattgtgagatgggagatggggaagaagcacgaattggcg
ctccctgatggtgttcagagtggccaggagattgagttccgtgatctttggcagactggc
tcagatgctctccctttcagaagtgctttcagagatgtcatttttcggaaaagctgggat
tcaagcgtcaagacaactacaggagccaaccacatcaatctcgaaccagaagcggaatcc
atcctcatccaattcaaagttttctgcccaaatattgagaaagacacatccatatacgtg
ataggcagcaatacaaaactggggcagtggaaagttgaaaatggactaaaactcagctat
gttggtgaatttgtctggttagctgaatgtgtgatacaaaggactttacagtcttcctta
acaattatttccacatacagatattgtaaatatggcaggtctgggaatgcttctatagaa
aatggtccaaatcgagaagtgtccattagcgcctcaagaagagaggcaaaatatattttt
ctttcagatggcatgatacgtgaaacaccctggcgtggtgctggtgtagcaattcctatg
ttctctatcaggtcagaatctgatctaggagttggagagtttctcgacctgaaattgcta
gttgactgggctgtagcatctggtttccatttagttcaacttttacctatcaatgataca
tctgtgcatcagatgtggtgggattcttatccatacaggtatagcagcaccttcaaaatc
attgctgttctcatatcaaatacacatcccagtcctctctttctttcactctcagtattt
gcgctgcatccgttgtacctgagagtgcaggcactttctgagaacataccagaggagata
aagcaagagattgagaaggcaaaacaacaattagatggcaaggaagttgattatgaagct
gcagtggctactaaactctcaattgctaagaaagttttcaatcaagagaaagatttgata
cttaattcgagttcctttcagcagttcttttctgagaatgagggttggttgaaaccctat
gctgccttctgtttcctgagagacttctttgaaacatcagaacgaagtcaatggggccgt
tttgctcaatactcagaagataagttagagaaacttgtatccacggaaagtctgcattac
gagataatttgcttccactactatgttcaataccatctacatttacaattgtctgaagct
tcagaatacgcaagaaagaagggagtgattctaaagggagatcttcccattggagttgac
agaaacagtgtggatacttgggtttatccaaatttgttccgaatgaacacttctactggg
gcacctcctgattattttgataaaaatggtcagaattggggctttcctacttataactgg
gaagagatgtcaaaagataactatggttggtggcgagctcgattaacacagatgggaaaa
tatttcacagcttacaggattgatcacatattgggattcttcagaatttgggaacttcca
gatcatgctgtgacaggtttagtaggaaaattccgaccatctattccactaagtcaggaa
gaacttgaaaaagaaggaatatgggactttaatcgcctgagccgcccatacattaggcaa
gaaatattacaggaaaaatttgggtctgcttgggcatttattgcaacagcttttctgaac
gaatatgacaagaactgctatgagttcaaggaggatagcaacacagagaaaaaaattgtt
tccaaactgaaaacttctggagaaagttctctgttgttggagagtgaagacaaaatgcgg
cgtaatctgatcgatcttttacagaatatagttctaatccgagacccagagaatccaaaa
gatttttatccgcgtttcaaccttgaagatacatcaagtttccaggctttggatgatcat
agcaagaatgttctcaaaagattgtattatgactactatttccatcgtcaagagaatctt
tggaggcaaaatgcgttgaagactctacctgcacttctaaattcatcagagatgctggct
tgcggggaagatttgggcctcattccttcttgtgtgcatcctgtatgtcaattatattcc
ttaagctctaataaacaagaacctccttctcactcgtgcgttatgcaagaactcggatta
gttgggttgcgcattcaacggatgcccaatgaatctgatctggaatttggtattccttct
caatacagctacatgacggtatgtgccccatcatgtcatgactgttccaccttgcgtgct
tggtgggaagaagacgaagaaagaagacaacggttcttcaagaatgtgatggaatctgat
gagttgccacctgatcaatgtgttccagaagttgcacattttattataaggcaacatatt
gaatccccatcaatgtgggcaattttcccccttcaggacttgttagcattaaaagaagaa
tatacagcacgccctgcaatagaagagacaatcaatgaccctacaaatccgaagcactat
tggagataccgtgtgcatgtgactctggagtcattgaataaagataatgagctgaaaacc
atcattaaagatcttgtacgttggggcggaagatcagttcctctagaggattcacaagct
gaagcaaatctaatctcaacatcatcagtagcagacaccgtctctgagaagcaacagttt
gccggtaccggagaaaagatccgtcatccttctgaatataatggaattccatcattgact
gcccgttga

DBGET integrated database retrieval system