KEGG   Medicago truncatula (barrel medic): MTR_7g088760Help
Entry
MTR_7g088760      CDS       T01716                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase-like protein
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 912 aa AA seqDB search
MTEVSMCYINSSELSPDEERIMIRDIALSSQTTPKEGDTFFIITQRWWQHWIEYVNQDQA
NPSYDGSSFPEHSDLVSSSAIKRPAGIDNYDLIDNTGSEDSSTGIEIHDTLLEGRDYVLL
PREVWDQLFKWYGGGPTLERKVISSGLSQTEFAVEVYPLRLQLLVLTRNVRSTIRISKKE
TIGQLHKRACEIFDLLLDQVRIWDYYGHRKHALMNDMDKTLDDVNLQMDQDILVEVVNNT
SSAQENGSVHREANSVLVEPTKSSVSTAGGLSTSKGASRGNNVEYYSSQKLNSPVRDSEN
PYGTLGVTTRGSFGGLIGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHQEINFQNPLG
MVGELALAFGELLRKLWAPGRTPIAPRPFKAKLARFAPQFSGHNQHDSQELLAFLLDGLH
EDLNRVKHKPYIKSRDADGRPDEEVADEYWANHISRNDSIIVDVCQGQYKSTLVCPVCNK
VSVTFDPFMYLSLPLQSTTNRTMTVTVFSCDSITLPSPCTVTVPKQGRCRDLIQALSNSC
SLKHNERIVLVEIRNHLIHRYFEDPLQLLSSIKDDDRLAAYKITKMDKNTKYLQLIHRRR
EQSSDSHTISGWKPYGTPIVSLISSDDKITRGDIQVMVNRILSPLLLKGDNAQQAASAET
NVVSNSINKDDTVSKATHLPTLPLLLVDDNNACIDLSMGEEKVVKLSPSSARVLVYIDWS
QKLLEKYDTRPLETLPEVLKYGPVTKKARTEPLSLYTCLEAFLREEPLVPEDMWYCPKCK
ERRQASKKLDLWRLPEVLVIHLKRFSYSRSMKHKLETFVNFPIHDFDLTNYIANKNNSRR
QVYELYALTNHYGSMGSGHYTAHIKLLDENRWYNFDDSHISLISEDDVNTAAAYVLFYRR
VKTDDDIVSNGV
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtgtcgatgtgttacatcaacagctccgaactgagtccagatgaagagaga
atcatgatcagagacattgctctttcttctcaaactactcccaaagaaggcgacaccttt
ttcatcatcactcagagatggtggcaacattggattgaatacgtgaaccaagatcaggca
aacccttcttatgatggatcttcctttcctgaacacagcgatttggtcagttcaagtgct
ataaagaggccagctggtattgataattatgatttgatcgataatactggatcagaagac
tctagtacgggtattgaaattcatgatacactgttagaagggcgtgactatgtattactt
cctcgagaggtttgggaccaattatttaaatggtatggtggtggacctacattggagagg
aaagttattagttcaggtctgtcccagacagaatttgcagtagaggtgtatcctttacgg
cttcaattacttgtgttaacaagaaatgttcgatctactataagaataagcaagaaggaa
accattggacagctacacaaaagagcttgtgaaatattcgatcttctgttggaccaagtg
cgcatttgggattactatggccatcggaagcatgccttgatgaatgacatggacaaaact
ctagatgatgtcaatctacaaatggaccaagatattcttgttgaggtcgtaaacaataca
agttctgctcaagaaaatggatcagtacatagggaagcgaattctgttcttgtggagcct
acaaaatcaagcgtatcaactgctggtggcctgtctactagcaagggtgcatctagaggc
aacaatgtcgaatattattcatctcagaaactaaattctcctgtcagagattcagaaaac
ccttatggtactcttggtgtcaccacaagaggttcattcggtggtctcattgggttgcta
aatcttggcaatacttgtttcatgaatagtgcaatacagtgccttgttcatacaccagag
ttcgctaggtactttagggaggactatcatcaagagataaattttcaaaatccactcggc
atggttggtgaactagccctagcatttggtgagttgcttcgaaaactatgggcacctggg
cgaacaccaattgctcctcgcccttttaaagcaaagcttgctcgttttgcacctcagttc
agtgggcacaaccaacacgattctcaggagctcttagcatttctgctggatggtctccat
gaagacttaaatcgtgtaaagcacaaaccatatataaagtctcgagatgctgatggccga
cccgatgaagaagtggctgatgaatattgggcaaatcatatttctcgtaatgattccata
attgttgatgtgtgccagggacaatacaagtcgactttggtgtgtccagtttgcaacaaa
gtctctgtcacatttgatcctttcatgtacctttccctgcctctccagtccaccaccaat
aggaccatgactgtgacagtttttagttgcgacagtattaccctgccttcgccgtgtaca
gtaactgtgcccaagcagggacgatgcagagatcttatacaagcacttagcaattcttgc
tcattgaagcataacgagaggatagtgcttgtggagatacgaaaccatttgatccataga
tattttgaagatcctcttcaattgttgtcctcaattaaagatgatgaccgccttgccgct
tacaagattacaaagatggacaaaaacactaagtacctccagttgatacatcgccgcaga
gagcagagtagtgactcgcataccatttcaggatggaaaccatatggaacacctattgtt
tcgttgatctcatctgatgataaaatcacaagaggtgacatacaagtaatggttaatcgt
atactctctcctcttctgttgaaaggtgacaatgcacaacaagctgcttctgctgaaact
aacgtggtgtcaaattcaataaataaggatgatacagtttcaaaggcgacacacctacca
acattacctctactattggtagatgataacaatgcttgcattgatctttcaatgggagag
gagaaagtagttaaactgtcaccgtcatcagcaagagttctagtgtatattgattggtct
cagaagcttctggaaaagtatgatactcgtccacttgagactttgccagaagttttgaaa
tatgggcctgtaaccaagaaagctcgtactgaacctctctctttgtacacttgtttggaa
gcttttctgcgtgaagaacctttggtgcctgaagacatgtggtactgtcctaaatgcaaa
gagagacgacaagcaagcaaaaagcttgatttatggaggctcccagaggttttggtaatt
catttaaaaaggttctcatacagcaggtcaatgaagcataaactcgagacttttgttaac
tttcccattcatgattttgatttaacaaattacatagccaataaaaacaactctcggcgt
caagtttatgaactctatgcccttacaaatcattatggtagtatgggtagtggacattat
actgcacatattaagcttttagacgaaaacaggtggtacaattttgatgatagccacata
tcactcataagtgaagacgatgttaatactgccgctgcctatgttctgttttaccggagg
gtgaaaaccgacgatgacattgtaagcaatggggtttag

DBGET integrated database retrieval system