KEGG   Medicago truncatula (barrel medic): MTR_7g092020Help
Entry
MTR_7g092020      CDS       T01716                                 

Definition
Guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mtr00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 394 aa AA seqDB search
MGEAPAFLVDDLQDGPLNGLELNNGTCKTTTVVGEKTYVTVGADDGTLSIDVQIFDRSLG
EWVHPTVLGTKPLSCNGHSAVLFENRILVLKKGSKSDDQIWFLEVDTEYVRQQRKKLGTE
VVAWSKGVIGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRAPRNMEKDGV
HYHFTEKSVMEKEIKSGKFLEFASVHGNLYGTSVEAVEVVADAGKRCILDIDVQGARSVR
ASSLEAIFIFVCPPSMEELEKRLRDRGTETEEQILKRLRNAQAEIEQGKSSNIFDFILYN
DNLEECYDRLKKLLGLDGFVATSPKSAAPREINLPTDHSVSKIDDKIIISCISSGLDKES
KNSIMLDVSSLKGGAPGRTRGLDFQVIGSMDQLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcaccagcattccttgttgatgaccttcaagatggacctcttaatggtctt
gaattgaataatggaacttgcaaaacaactactgtcgttggcgaaaaaacgtatgtcact
gttggagctgatgatggaactttgtccattgacgttcaaatttttgaccgtagtcttgga
gaatgggttcacccaactgtgctaggcaccaaacccttgtcatgcaatggacactcagcc
gtgcttttcgaaaaccggatcctagttcttaagaagggttccaaatcagatgaccagata
tggtttctagaggtggacactgaatatgttaggcagcagcggaaaaaattggggactgag
gtggttgcttggagtaagggtgtgataggcaatgctgagaaacctattgttattagtggt
ccttctggagttggtaaaggaacactgatatcaatgctcatgaaggaattcccttcgatg
tttggtttttctgtgagtcatacaacccgtgctccgagaaatatggagaaagatggggtc
cattaccattttaccgagaagagtgtgatggagaaagagattaaaagtggaaagtttctc
gaatttgcttctgtccatggtaatttgtatgggaccagtgttgaggctgttgaagtggta
gcagatgcaggaaaaaggtgcattcttgatattgatgttcaaggagcaagatctgttagg
gctagttctcttgaagccatattcatctttgtctgtccaccatcaatggaagagcttgag
aagcgccttcgtgacagagggactgagactgaggaacagatcctgaagcgactgcgtaat
gctcaggctgagattgagcaaggaaagtcttcgaatatatttgatttcatcttatacaat
gacaaccttgaagagtgttatgacagacttaagaaattactgggacttgatggttttgtc
gcaacttcacccaaatcagcagcacctagagagattaatctaccaacagatcattcagtg
tctaaaattgatgacaaaatcatcataagctgcatctcttctggacttgacaaggagtca
aagaattctatcatgttggatgtttcctcactgaaagggggtgcacctggaaggacaaga
ggacttgattttcaagtcataggctctatggatcagcttagctaa

DBGET integrated database retrieval system