KEGG   Medicago truncatula (barrel medic): MTR_7g099880Help
Entry
MTR_7g099880      CDS       T01716                                 

Definition
Nuclear pore complex protein Nup205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_7g099880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 2047 aa AA seqDB search
MVSPKQLLSTLESALLGSSPPTPSQRIEVLHAIRSSLQSIQSLLSYPPPNSSDRAQVQSK
SIRLQDSTLITLDDNDVQIALKLSDDLHLNEVDCVRLLVSANQEFWPPRILLTYSSLTWH
PYPLSEVTLQVEGKICKTDNVVWDRICWVVKNQHGNKFSVAETRMLCGMCGKTRRDKIRK
DNIRESRVSPIVENMVETGETIKKDLEINWGLMGREQLEILRLAAGLWYTERRYLITSLH
LLLRAVVLDQGLEDDILLDIQKYLEDVVNSGLRQRLISLIKELNREEPSGVGGPQCERYV
IDSRGSLVERQAVVSRERLILGHCLVLSVLIVRTSPKDVKDLFSVLKDSASEVSQSNTAI
KHQITFSLLFALVIAFVSDGLSTVPDKASVLSSNTSFRHEFHELVMATGNDPIVEGFTGG
IRLAWVVHLMLIQDGVAARETVSSASSNEMSYLSQCLETVFSNNVFQFLLEKVLRTAAFQ
TEDEDMIYMYNAYLHKLITCFLSNPLARDKIKESKEKVMSVLSPYRVVGSHDFAQNSSSV
SQQGTEAGSLPFNSILDFVSEIYLKEPELLLGNDVLWTFVNFAGEDHTNFQTLVAFLNML
STLASSQEGASKVHELLQGKAFRSIGWSTLFECLTIYDEKFKQSLQTAGAMLPEIQEGDA
KALVAYLNVLKKVVENGNPIERKNWFPDIEPLFKLLSYENVPPYLKGALRNAIATFIHVS
PVLKDSIWTFLEQYDLPVVVGPEAQGSPSMGTQVYDMQFELNEIEARREQYPSTISFLNL
INALIAEERDLTDRGRRFIGIFRFIYDHVFGPYPQRAYADPCEKWQLVGACLKHFHMILT
MYDVKEEDYEGVVDQSRLSTTKETSSLQTQLPVLELLKDFMSGKTVFRNIMSILLPGVNS
IIDERSSQIYGQYLENAVQLSLEIIILVLEKDLLLSDYWRPLYQPLDIILSHDHNQIVAL
LEYVRYDFQPKVQQSSIKIMSILSSRMVGLVQLLLKSNASNSLIEDYAACLEARSEESQN
VENNNNNNNNDPGILILQLLIDNISRPAPNITHLLLRFDLDTPVERTVLQPKFYYSCMKV
ILDILEKLSKPDVNALLHEFGFQLLYELCIDAFTSVPTMDLLSNKKYRFFVKHLDAIGIA
PLPKRNNNQPLRISSLHQRAWLLKLLAVELHAGDVSSSNHREACQTILSNLFGQGTTGID
GEQAIYPFSLQDNSGNGDFRTVSKSKVLDLLEIIQFRCPDPTTKLSNTTASMKYNLLAED
ILGNPGNSGKGGVYYYSERGDRLIDLASFHDKLWQMSNLGNEVELNDVRETIQQLLRWGW
KYNKNLEEQASQLHMLTAWSQSVEVSASRRLVMLEDRSEILFQILDASLSASASPDCSLK
MAFILSQSLSAQRAASWPKAVTGSHNDSFLRTWSVPQVALTCMAKLRDERFMFPGNLSSD
SITCLDLIVVKQLSNGACLTILFKLIMAILRNESSEALRRRYVTRSVLDFDCVAVYCFGR
QTYFCMSLYRQYALLLSYFQYCLNVVDPDVPTSVLQFLLLSEQDNEYIDLPKIDKEQAEL
ARANFSTLRKEAQSILDLVIKDATHGSESGKTISLYVLDALICIDHERYFLSQLQSRGFL
RSCLTAISNISNQDGGLSLDSLQRACTFEAELAVLLRISHKYGKSGAQVLFTMGILEHLS
SGRATNSQGGLRWAEKRLRRDMAVDVDRQQMIITPVLRLVYSLTSLVDTSDYMEVKNKIV
REVIDFVKGHQSLFAQVLRLEIAEADELRMEQINLVVGILSKVWPYEESDEYGFVQGLFG
LMNVLFSRDSNSKVLGFPRSRVSPENQRSSELQIFKLCFSLSSYLYFLVTKKSLRLQSSD
ASSSYPTSVEFQQPSLSLLNSLLSSATTALERAAEEKSLLLNKIRDINELARQEVDEIIS
MCVRQESASSSDNIQRRRYIAMVEMCRVVSCTDQLIVLLLPLSEHVLNIILVHLQDCSDA
FESTMTTKTITYGAKCDPQQDLALLCGQLVPTLERLELLSEEKLGHTLKVFCRLATSAKE
IAIQKMI
NT seq 6144 nt NT seq  +upstreamnt  +downstreamnt
atggtttctccgaagcagcttctatccaccttggaatcagcgcttctcggttcctcgcct
ccaacgccgtcgcaacgaatcgaagtgttgcacgcgattcgaagttctcttcaatccatc
caatcgcttctttcctatccccctccgaattcctccgatcgagctcaagttcagtcgaag
tcaattcggcttcaagattctactcttatcacacttgatgataatgatgtgcagattgca
ctcaaattgagtgatgatttgcatctaaatgaagtcgattgtgttcgattgctagtatcc
gctaaccaagagttttggcccccaaggatacttttgacatactcttcgctgacgtggcac
ccatatcccttaagtgaggttacccttcaagttgaagggaaaatttgtaagaccgacaat
gttgtatgggatagaatttgttgggttgttaagaaccaacacggaaataaattcagcgtt
gcagagacgaggatgttgtgtgggatgtgtggtaagactagacgggataagattagaaaa
gacaacattagagagagtcgggtttcacctatagtagaaaatatggtggaaactggagaa
actattaagaaagatctagagattaattggggtttaatgggcagggaacagctggaaatt
ctacggcttgcagcaggactctggtatacagaaagaagatatctgataacatccctccat
cttctgttgagggccgtggtgcttgatcagggacttgaagatgatatattgcttgacata
caaaaatatctagaagatgttgtaaattctggacttcgacagcggttaatttctctaatc
aaggaactcaatagagaagagccttctggtgtgggaggtcctcagtgtgaacgctatgtt
attgattcaagaggttctcttgtggagaggcaggcagtggtctctagagaaagacttatc
ttgggacattgtcttgtcctttctgttcttattgttcgaacaagtcctaaggatgtaaaa
gacttattctcagttttgaaagatagtgcttctgaagttagtcagagcaatactgccata
aaacatcagattacctttagccttctatttgcccttgtgattgcatttgtttcagatggt
ttgagtacagtgcctgacaaagcatctgtcctttcttctaatacatccttcagacatgaa
tttcatgaacttgtaatggccactggaaatgatccaattgttgagggattcactggtggc
ataaggcttgcttgggtggtacatttgatgttaatacaagacggtgttgcagcaagggaa
actgtttcgagtgcttcatcaaatgaaatgagttatcttagtcaatgcttagaaaccgtt
ttttcaaataatgtttttcagtttttattggagaaagttcttcgaactgctgcgtttcag
actgaagatgaagatatgatctatatgtacaatgcttatttgcacaagctgatcacatgc
ttcttgtctaaccctctagctagagacaagataaaagaatccaaggagaaggttatgagt
gtgcttagtccataccgagttgttggatcacatgattttgcacagaacagtagctcagtt
tctcaacaaggcaccgaagcaggctctttaccatttaattcaatcttggacttcgtgagc
gaaatttatctgaaagaaccagagcttttgttgggaaatgatgtgctgtggacatttgta
aattttgctggagaggaccatacaaattttcaaacgcttgtggctttcttgaatatgctg
agcaccttggcttccagtcaagaaggtgcttcaaaggttcatgagttgctgcaaggtaaa
gcatttcgctcgattggctggagcactttgtttgaatgcttaacaatttatgatgagaaa
ttcaaacagtctcttcaaactgctggagcaatgttgcctgaaattcaggagggggatgca
aaagcacttgtggcatatttaaatgttctgaagaaggttgtggaaaatgggaaccctata
gaaaggaaaaactggtttcctgatattgaaccactgtttaaactccttagttatgaaaat
gtacccccttatcttaagggtgctctaaggaatgcaatagccacatttattcacgtctcc
ccagtgttgaaggatagcatctggacttttcttgagcaatatgatctgccagtagttgtt
gggcccgaagcccagggcagtccatccatgggtactcaggtttatgatatgcaatttgaa
ttaaatgaaattgaggcaagaagagaacaatacccttcaactatatctttccttaatttg
ataaatgctcttattgcggaagaaagagatttgactgatagagggcgaagatttattggc
atctttaggttcatctatgatcatgtttttgggccatatcctcaaagagcatatgcagat
ccctgcgaaaaatggcagttggttggtgcttgccttaaacattttcacatgatactaacg
atgtacgatgttaaggaagaagactatgagggtgtagttgaccagtcccgactttcaaca
acaaaagaaacatcatcacttcagacacagcttcctgttttagagttgctgaaggatttc
atgagtggaaagactgtcttccggaacatcatgagtattcttctgccaggggtgaattcc
atcattgatgaacgcagtagtcaaatatatgggcagtatttagagaatgcggtgcagctt
tctttggaaattataatacttgtccttgaaaaagatttacttctttctgattattggcgt
cctctgtaccagccattggatattatactctcgcatgatcacaatcaaatagtggcactg
ttggagtatgtcagatatgattttcagccaaaagttcagcaatcatctatcaaaatcatg
agtattttaagctctcgtatggttgggcttgttcagctattgttaaaatctaatgcctca
aacagtttgatagaagattatgcagcctgtctcgaggcacggtcagaagagtctcagaat
gttgaaaataacaacaataataataataacgatcctggcattcttattctgcaacttcta
attgacaacatcagcagaccagctccaaatatcactcatttactacttagatttgatcta
gatacgcctgttgagcggacagttttacagccaaaattttattacagttgcatgaaggtt
attcttgatattctggagaagctttcgaagccagatgtaaatgcgttacttcatgaattt
ggttttcagcttctctatgagttgtgcattgatgcatttacttctgttcctacaatggat
ctgttgtcaaataaaaagtaccgattctttgttaagcaccttgacgcaattggcattgct
ccactgcctaaacgtaataacaaccaaccgcttcgtatcagttcccttcatcagagagca
tggctcttgaagcttttagcagttgagctacatgctggtgatgttagcagctccaatcat
agagaagcttgtcagacaatcctttctaatctttttggacaaggtaccactggaattgat
ggagagcaggctatatatccattttcacttcaagataattctggaaatggtgattttaga
actgtcagtaagagtaaggtattagacttgcttgaaatcatccagtttagatgtccagat
cccactacgaagttgtcaaatactacggccagtatgaagtataacttgctggcagaagac
atactgggaaatccaggaaattctggaaagggtggtgtctactattattctgagagaggt
gaccgattgattgaccttgcttccttccatgacaaactttggcagatgagtaatcttggc
aatgaagttgagctaaatgatgtacgagagacaattcaacagttgctgagatggggatgg
aaatacaataaaaatcttgaagagcaagcttcacaactacatatgttgactgcctggtct
cagagtgttgaggtgtctgcatctagaagattagtgatgcttgaagatcggtcggaaatt
ctctttcagatccttgacgcgtctctcagtgcatctgcttctccagactgttcactgaag
atggcattcatattatcacagtcgttgagtgcccaaagggcagcatcctggcccaaagca
gtcaccgggtcgcataatgattcatttttacgtacatggagtgtccctcaggtagcattg
acatgcatggctaaactgcgagatgaaaggtttatgttccctggaaatttaagctctgac
agtataacatgccttgatctcattgtggttaaacaattatcaaatggtgcttgcttgacc
atattgtttaagcttatcatggcaattcttagaaacgaatcatcagaagctcttaggaga
cggtatgttacacgttctgtacttgattttgattgtgtagctgtgtattgttttggccgg
caaacttacttttgcatgtctttgtacagacaatatgccttgcttcttagctatttccag
tattgtttgaatgtggttgatcctgatgttccaacctcagttcttcaattcttgcttctc
agtgaacaagataacgaatatattgatctcccgaagattgacaaagaacaggcagaactg
gctcgtgcaaatttttctactttgaggaaagaggctcagagcatattagatttggtcata
aaggatgcaacccatggcagtgaatctggaaaaacaatatcactctatgttcttgacgcg
ttgatttgtatagatcatgagcgatatttcttgagccaacttcaaagcaggggattttta
cggtcttgccttactgccataagcaatatttccaatcaggatggtggtctttcattggac
tctttgcagagggcatgtacctttgaggctgaacttgctgtattactaagaatcagtcac
aaatatgggaaatctggagcacaggtactatttaccatgggtatattggagcatctttca
tctggcagggcaaccaattcgcagggaggattaaggtgggctgagaaaagacttagaaga
gatatggctgtggatgttgatagacaacagatgattataactccggtcttgagattagtc
tattcattaacttccttggttgatacatcagattatatggaggtgaaaaacaaaattgtt
cgtgaagtgattgattttgtcaaagggcatcaatcactctttgctcaagttctccgttta
gaaattgctgaagcagatgagttaagaatggagcagatcaatcttgtagttggtattcta
agcaaggtttggccatatgaagagagtgatgaatatggctttgttcaagggctttttggt
ttgatgaatgttcttttctctcgtgactcaaactcaaaggttctaggttttcctcgatcg
agagtgtcccctgagaatcagagaagttcagaactacagatatttaagttgtgcttcagc
ctgagctcttacttatattttctagtcacaaagaaatccttgagattacagtcttccgat
gcctcctccagttaccctacttctgttgaatttcaacaaccttcattgagcttgcttaat
tctttactcagttcagctacaactgcactggaaagagcagccgaggagaaatccttatta
ctgaacaagattcgagacataaatgaactggcaaggcaggaggtggatgaaatcatcagt
atgtgtgtccggcaagaatctgcatcatcttctgataacatacaaagaaggagatacata
gcaatggtagagatgtgtcgagttgtttcttgtacggatcagctaattgtcttattgctc
ccgctctcggaacatgtgctaaatatcatcctcgtccaccttcaggattgctctgacgca
tttgaatctaccatgaccacgaaaacaattacatatggtgcaaagtgtgatccacaacag
gacttggctttgttatgtggacagttagttccaacccttgaaagacttgaactgctgagt
gaggagaaattagggcatactctcaaagtattctgccgattagcaacttcggccaaagaa
attgcgatccagaagatgatttag

DBGET integrated database retrieval system