KEGG   Medicago truncatula (barrel medic): MTR_7g099880Help
Entry
MTR_7g099880      CDS       T01716                                 

Definition
(RefSeq) nuclear pore complex Nup205-like protein
  KO
K14310  
nuclear pore complex protein Nup205
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MTR_7g099880
Messenger RNA biogenesis [BR:mtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     MTR_7g099880
Chromosome [BR:mtr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    MTR_7g099880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1883 aa AA seqDB search
MVSPKQLLSTLESALLGSSPPTPSQRIEVLHAIRSSLQSIQSLLSYPPPNSSDRAQVQSK
SIRLQDSTLITLDDNDVQIALKLSDDLHLNEVDCVRLLVSANQEWGLMGREQLEILRLAA
GLWYTERRYLITSLHLLLRAVVLDQGLEDDILLDIQKYLEDVVNSGLRQRLISLIKELNR
EEPSGVGGPQCERYVIDSRGSLVERQAVVSRERLILGHCLVLSVLIVRTSPKDVKDLFSV
LKDSASEVSQSNTAIKHQITFSLLFALVIAFVSDGLSTVPDKASVLSSNTSFRHEFHELV
MATGNDPIVEGFTGGIRLAWVVHLMLIQDGVAARETVSSASSNEMSYLSQCLETVFSNNV
FQFLLEKVLRTAAFQTEDEDMIYMYNAYLHKLITCFLSNPLARDKIKESKEKVMSVLSPY
RVVGSHDFAQNSSSVSQQGTEAGSLPFNSILDFVSEIYLKEPELLLGNDVLWTFVNFAGE
DHTNFQTLVAFLNMLSTLASSQEGASKVHELLQGKAFRSIGWSTLFECLTIYDEKFKQSL
QTAGAMLPEIQEGDAKALVAYLNVLKKVVENGNPIERKNWFPDIEPLFKLLSYENVPPYL
KGALRNAIATFIHVSPVLKDSIWTFLEQYDLPVVVGPEAQGSPSMGTQVYDMQFELNEIE
ARREQYPSTISFLNLINALIAEERDLTDRGRRFIGIFRFIYDHVFGPYPQRAYADPCEKW
QLVGACLKHFHMILTMYDVKEEDYEGVVDQSRLSTTKETSSLQTQLPVLELLKDFMSGKT
VFRNIMSILLPGVNSIIDERSSQIYGQYLENAVQLSLEIIILVLEKDLLLSDYWRPLYQP
LDIILSHDHNQIVALLEYVRYDFQPKVQQSSIKIMSILSSRMVGLVQLLLKSNASNSLIE
DYAACLEARSEESQNVENNNNNNNNDPGILILQLLIDNISRPAPNITHLLLRFDLDTPVE
RTVLQPKFYYSCMKVILDILEKLSKPDVNALLHEFGFQLLYELCIDAFTSVPTMDLLSNK
KYRFFVKHLDAIGIAPLPKRNNNQPLRISSLHQRAWLLKLLAVELHAGDVSSSNHREACQ
TILSNLFGQGTTGIDGEQAIYPFSLQDNSGNGDFRTVSKSKVLDLLEIIQFRCPDPTTKL
SNTTASMKYNLLAEDILGNPGNSGKGGVYYYSERGDRLIDLASFHDKLWQMSNLGNEVEL
NDVRETIQQLLRWGWKYNKNLEEQASQLHMLTAWSQSVEVSASRRLVMLEDRSEILFQIL
DASLSASASPDCSLKMAFILSQVALTCMAKLRDERFMFPGNLSSDSITCLDLIVVKQLSN
GACLTILFKLIMAILRNESSEALRRRQYALLLSYFQYCLNVVDPDVPTSVLQFLLLSEQD
NEYIDLPKIDKEQAELARANFSTLRKEAQSILDLVIKDATHGSESGKTISLYVLDALICI
DHERYFLSQLQSRGFLRSCLTAISNISNQDGGLSLDSLQRACTFEAELAVLLRISHKYGK
SGAQVLFTMGILEHLSSGRATNSQGGLRWAEKRLRRDMAVDVDRQQMIITPVLRLVYSLT
SLVDTSDYMEVKNKIVREVIDFVKGHQSLFAQVLRLEIAEADELRMEQINLVVGILSKVW
PYEESDEYGFVQGLFGLMNVLFSRDSNSKVLGFPRSRVSPENQRSSELQIFKLCFSLSSY
LYFLVTKKSLRLQSSDASSSYPTSVEFQQPSLSLLNSLLSSATTALERAAEEKSLLLNKI
RDINELARQEVDEIISMCVRQESASSSDNIQRRRYIAMVEMCRVVSCTDQLIVLLLPLSE
HVLNIILVHLQDCSDAFESTMTTKTITYGAKCDPQQDLALLCGQLVPTLERLELLSEEKL
GHTLKVFCRLATSAKEIAIQKMI
NT seq 5652 nt NT seq  +upstreamnt  +downstreamnt
atggtttctccgaagcagcttctatccaccttggaatcagcgcttctcggttcctcgcct
ccaacgccgtcgcaacgaatcgaagtgttgcacgcgattcgaagttctcttcaatccatc
caatcgcttctttcctatccccctccgaattcctccgatcgagctcaagttcagtcgaag
tcaattcggcttcaagattctactcttatcacacttgatgataatgatgtgcagattgca
ctcaaattgagtgatgatttgcatctaaatgaagtcgattgtgttcgattgctagtatcc
gctaaccaagagtggggtttaatgggcagggaacagctggaaattctacggcttgcagca
ggactctggtatacagaaagaagatatctgataacatccctccatcttctgttgagggcc
gtggtgcttgatcagggacttgaagatgatatattgcttgacatacaaaaatatctagaa
gatgttgtaaattctggacttcgacagcggttaatttctctaatcaaggaactcaataga
gaagagccttctggtgtgggaggtcctcagtgtgaacgctatgttattgattcaagaggt
tctcttgtggagaggcaggcagtggtctctagagaaagacttatcttgggacattgtctt
gtcctttctgttcttattgttcgaacaagtcctaaggatgtaaaagacttattctcagtt
ttgaaagatagtgcttctgaagttagtcagagcaatactgccataaaacatcagattacc
tttagccttctatttgcccttgtgattgcatttgtttcagatggtttgagtacagtgcct
gacaaagcatctgtcctttcttctaatacatccttcagacatgaatttcatgaacttgta
atggccactggaaatgatccaattgttgagggattcactggtggcataaggcttgcttgg
gtggtacatttgatgttaatacaagacggtgttgcagcaagggaaactgtttcgagtgct
tcatcaaatgaaatgagttatcttagtcaatgcttagaaaccgttttttcaaataatgtt
tttcagtttttattggagaaagttcttcgaactgctgcgtttcagactgaagatgaagat
atgatctatatgtacaatgcttatttgcacaagctgatcacatgcttcttgtctaaccct
ctagctagagacaagataaaagaatccaaggagaaggttatgagtgtgcttagtccatac
cgagttgttggatcacatgattttgcacagaacagtagctcagtttctcaacaaggcacc
gaagcaggctctttaccatttaattcaatcttggacttcgtgagcgaaatttatctgaaa
gaaccagagcttttgttgggaaatgatgtgctgtggacatttgtaaattttgctggagag
gaccatacaaattttcaaacgcttgtggctttcttgaatatgctgagcaccttggcttcc
agtcaagaaggtgcttcaaaggttcatgagttgctgcaaggtaaagcatttcgctcgatt
ggctggagcactttgtttgaatgcttaacaatttatgatgagaaattcaaacagtctctt
caaactgctggagcaatgttgcctgaaattcaggagggggatgcaaaagcacttgtggca
tatttaaatgttctgaagaaggttgtggaaaatgggaaccctatagaaaggaaaaactgg
tttcctgatattgaaccactgtttaaactccttagttatgaaaatgtacccccttatctt
aagggtgctctaaggaatgcaatagccacatttattcacgtctccccagtgttgaaggat
agcatctggacttttcttgagcaatatgatctgccagtagttgttgggcccgaagcccag
ggcagtccatccatgggtactcaggtttatgatatgcaatttgaattaaatgaaattgag
gcaagaagagaacaatacccttcaactatatctttccttaatttgataaatgctcttatt
gcggaagaaagagatttgactgatagagggcgaagatttattggcatctttaggttcatc
tatgatcatgtttttgggccatatcctcaaagagcatatgcagatccctgcgaaaaatgg
cagttggttggtgcttgccttaaacattttcacatgatactaacgatgtacgatgttaag
gaagaagactatgagggtgtagttgaccagtcccgactttcaacaacaaaagaaacatca
tcacttcagacacagcttcctgttttagagttgctgaaggatttcatgagtggaaagact
gtcttccggaacatcatgagtattcttctgccaggggtgaattccatcattgatgaacgc
agtagtcaaatatatgggcagtatttagagaatgcggtgcagctttctttggaaattata
atacttgtccttgaaaaagatttacttctttctgattattggcgtcctctgtaccagcca
ttggatattatactctcgcatgatcacaatcaaatagtggcactgttggagtatgtcaga
tatgattttcagccaaaagttcagcaatcatctatcaaaatcatgagtattttaagctct
cgtatggttgggcttgttcagctattgttaaaatctaatgcctcaaacagtttgatagaa
gattatgcagcctgtctcgaggcacggtcagaagagtctcagaatgttgaaaataacaac
aataataataataacgatcctggcattcttattctgcaacttctaattgacaacatcagc
agaccagctccaaatatcactcatttactacttagatttgatctagatacgcctgttgag
cggacagttttacagccaaaattttattacagttgcatgaaggttattcttgatattctg
gagaagctttcgaagccagatgtaaatgcgttacttcatgaatttggttttcagcttctc
tatgagttgtgcattgatgcatttacttctgttcctacaatggatctgttgtcaaataaa
aagtaccgattctttgttaagcaccttgacgcaattggcattgctccactgcctaaacgt
aataacaaccaaccgcttcgtatcagttcccttcatcagagagcatggctcttgaagctt
ttagcagttgagctacatgctggtgatgttagcagctccaatcatagagaagcttgtcag
acaatcctttctaatctttttggacaaggtaccactggaattgatggagagcaggctata
tatccattttcacttcaagataattctggaaatggtgattttagaactgtcagtaagagt
aaggtattagacttgcttgaaatcatccagtttagatgtccagatcccactacgaagttg
tcaaatactacggccagtatgaagtataacttgctggcagaagacatactgggaaatcca
ggaaattctggaaagggtggtgtctactattattctgagagaggtgaccgattgattgac
cttgcttccttccatgacaaactttggcagatgagtaatcttggcaatgaagttgagcta
aatgatgtacgagagacaattcaacagttgctgagatggggatggaaatacaataaaaat
cttgaagagcaagcttcacaactacatatgttgactgcctggtctcagagtgttgaggtg
tctgcatctagaagattagtgatgcttgaagatcggtcggaaattctctttcagatcctt
gacgcgtctctcagtgcatctgcttctccagactgttcactgaagatggcattcatatta
tcacaggtagcattgacatgcatggctaaactgcgagatgaaaggtttatgttccctgga
aatttaagctctgacagtataacatgccttgatctcattgtggttaaacaattatcaaat
ggtgcttgcttgaccatattgtttaagcttatcatggcaattcttagaaacgaatcatca
gaagctcttaggagacgacaatatgccttgcttcttagctatttccagtattgtttgaat
gtggttgatcctgatgttccaacctcagttcttcaattcttgcttctcagtgaacaagat
aacgaatatattgatctcccgaagattgacaaagaacaggcagaactggctcgtgcaaat
ttttctactttgaggaaagaggctcagagcatattagatttggtcataaaggatgcaacc
catggcagtgaatctggaaaaacaatatcactctatgttcttgacgcgttgatttgtata
gatcatgagcgatatttcttgagccaacttcaaagcaggggatttttacggtcttgcctt
actgccataagcaatatttccaatcaggatggtggtctttcattggactctttgcagagg
gcatgtacctttgaggctgaacttgctgtattactaagaatcagtcacaaatatgggaaa
tctggagcacaggtactatttaccatgggtatattggagcatctttcatctggcagggca
accaattcgcagggaggattaaggtgggctgagaaaagacttagaagagatatggctgtg
gatgttgatagacaacagatgattataactccggtcttgagattagtctattcattaact
tccttggttgatacatcagattatatggaggtgaaaaacaaaattgttcgtgaagtgatt
gattttgtcaaagggcatcaatcactctttgctcaagttctccgtttagaaattgctgaa
gcagatgagttaagaatggagcagatcaatcttgtagttggtattctaagcaaggtttgg
ccatatgaagagagtgatgaatatggctttgttcaagggctttttggtttgatgaatgtt
cttttctctcgtgactcaaactcaaaggttctaggttttcctcgatcgagagtgtcccct
gagaatcagagaagttcagaactacagatatttaagttgtgcttcagcctgagctcttac
ttatattttctagtcacaaagaaatccttgagattacagtcttccgatgcctcctccagt
taccctacttctgttgaatttcaacaaccttcattgagcttgcttaattctttactcagt
tcagctacaactgcactggaaagagcagccgaggagaaatccttattactgaacaagatt
cgagacataaatgaactggcaaggcaggaggtggatgaaatcatcagtatgtgtgtccgg
caagaatctgcatcatcttctgataacatacaaagaaggagatacatagcaatggtagag
atgtgtcgagttgtttcttgtacggatcagctaattgtcttattgctcccgctctcggaa
catgtgctaaatatcatcctcgtccaccttcaggattgctctgacgcatttgaatctacc
atgaccacgaaaacaattacatatggtgcaaagtgtgatccacaacaggacttggctttg
ttatgtggacagttagttccaacccttgaaagacttgaactgctgagtgaggagaaatta
gggcatactctcaaagtattctgccgattagcaacttcggccaaagaaattgcgatccag
aagatgatttag

DBGET integrated database retrieval system