KEGG   Medicago truncatula (barrel medic): MTR_7g099960Help
Entry
MTR_7g099960      CDS       T01716                                 

Definition
Histone H2B
Orthology
K11252  
histone H2B
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MTR_7g099960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 138 aa AA seqDB search
MPPTKAEKKPAEKKPAEKAPAEKKPKAEKKISKEGSSDKKKKRTKKSVETYKIYIFKVLK
QVHPDIGVSSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGEL
AKHAVSEGTKAVTKFTSS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaacaaaggcagagaagaaacccgcggagaagaagcccgcagagaaagctcca
gccgagaagaaaccaaaagcggagaagaagatctcaaaggaaggaagcagcgacaagaag
aagaagagaacgaagaaaagcgttgaaacctacaagatatacatcttcaaggttctgaaa
caggttcatcctgatatcggtgtttcaagcaaggctatgggaatcatgaacagtttcatt
aacgatatctttgagaaactcgctcaggaatcgtctcgtttggctaggtataacaagaag
ccgacgattacttctagggagattcaaactgctgttagattggttcttcctggagaattg
gctaaacatgctgtttctgaagggactaaggctgttaccaaattcaccagctcttga

DBGET integrated database retrieval system