KEGG   Medicago truncatula (barrel medic): MTR_7g104080Help
Entry
MTR_7g104080      CDS       T01716                                 

Definition
(RefSeq) starch branching enzyme I
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTR_7g104080
Enzymes [BR:mtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MTR_7g104080
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTR_7g104080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 877 aa AA seqDB search
MVYTISGIRFPVVPSLNKSSLRGGDRRTSSSHSFFLKKNSSSFSKTSLYAKFSHDSETKS
STIAESDKVLIPEDQDNSASVTDQLENPDITSEDAQSFQNLEDLTMKDENKYNVDEAASS
YREVGDDKGSVMPSSLVDVKTDAQAKKTSVHSDKKVKTDKPKVIPPPGAGQKIYEIDTFL
QAHRQHLDFRYGQYKKIREEIDKYEGGLDAFSRGYEKLGFTRSATGITYREWAPGAKSAA
LVGDFNNWNPNADVMTRDDFGVWEIFLPNNADGSPPIPHGSRVKIHMDTPSGIKDSIPAW
IKFSVQAPGEIPYNGIYYDPPEEEKYVFKHPQPKRPQSIRIYEAHVGMSSPEPKINTYAN
FRDDVLPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEDLKSLIDRAHE
LGLLVLMDIVHSHASSNTLDGLNMFDGTDAHYFHSGSRGYHWMWDSRLFNYGSWEVLRYL
LSNARWWLDEYKFDGFRFDGVTSMMYTHHGLQVSFTGNYNEYFGFATDVEAVVYLMLVND
LIHGLYPEAVSIGEDVSGMPTFCLPTQDGGIGFNYRLHMAVADKWIDLLKKKDEDWRMGD
IVHTLTNRRWLENCVVYAESHDQALVGDKTLAFWLMDKDMYDFMALDRPSTPLIDRGIAL
HKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGDQHLPNGTVVPGNNNSYDKCRRRFD
LGDAEYLRYHGMQEFDRAMQHLEERYGFMISEHQYISRKNEGDRVIIFERDNLVFVFNFH
WTNSYSDYKVGCLKPGKYKIVLDSDESLFGGFNRLNHTAEYFTSEGWYDDRPRSFLVYAP
CRTAVVYALVDGVESEPVELSVGVESETIQQSVEVEP
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atggtttataccatttctggaattcgatttcccgttgttccttctctgaataagtccagc
ttacgtggtggcgatcgcagaacttcttcttctcactccttctttctcaagaagaattca
tcatcattctcgaagacttcactatatgcaaagttttcccatgattctgaaaccaaatct
tccacaattgctgaatctgataaagtacttattccagaagatcaagataactctgcatcc
gtgacggatcaacttgaaaatcctgatataacctcagaggatgcacagtcttttcagaac
ttggaggatttaaccatgaaagatgagaataagtacaatgttgatgaagcagctagcagt
tatagagaggtcggggatgacaaaggttctgttatgccatcatcacttgtggatgttaaa
actgacgctcaagccaagaagacatcagttcattcagacaagaaagtaaaaacagataaa
cctaaggtcattcctccacctggtgctggacagaaaatatatgagattgatacattttta
caagcacaccgtcagcatcttgatttccgctatggacagtacaaaaaaattcgggaggaa
attgacaagtatgaaggtggtcttgatgcattttctcgtgggtacgaaaagttaggcttc
acacgcagtgctacaggcattacttacagagagtgggcacctggagctaagtcagcagca
ttagttggagatttcaataattggaatccaaatgcagatgtaatgacccgggacgatttt
ggtgtgtgggagatcttcttgccaaataatgccgatggttcaccaccaattcctcatggt
tctcgagtcaagatccacatggatacaccctctgggatcaaggactcaattcctgcttgg
atcaaattctctgtacaggctcctggtgaaattccatataatggaatatactatgatccc
ccagaggaggaaaaatatgtcttcaaacatccacagccaaagcgaccgcaatcaattagg
atatatgaggcacatgttggaatgagtagcccagagccaaaaatcaacacatatgccaat
tttagagatgatgtactgcctcgcattaaaaagcttggctataatgctgtccagattatg
gctatccaagaacattcttactatgctagctttgggtaccatgttactaatttctttgca
cctagcagtcggtttggaactccagaagatcttaagtctctgatagacagagcccatgaa
ctaggcctgcttgttctgatggatattgtacatagccatgcatcaagtaatacattggat
ggcctcaacatgtttgatggaaccgatgctcattatttccattctggttcacggggttat
cattggatgtgggattctcgcctttttaactatggaagctgggaagtcctaaggtatcta
ctttcaaatgctagatggtggctggatgaatataagtttgatgggtttcgatttgatggt
gtcacatcaatgatgtacactcatcatggactgcaggtatcttttactggaaattacaat
gagtattttggttttgcaactgatgttgaagctgtggtttacctgatgcttgttaatgat
ctcattcatgggctctatcctgaagctgtttcaattggtgaagatgtgagtggaatgcca
acattctgccttccaacacaagatggtgggattggctttaactatcgcttgcatatggcc
gttgcagacaagtggattgaccttcttaagaaaaaggatgaagattggagaatgggtgat
atagtccacacactgacaaacagaaggtggctagaaaattgtgtggtttatgctgaaagt
catgaccaagccttggttggtgacaagacactagcattttggttgatggacaaggatatg
tatgacttcatggctttagacagaccatctactcctctaatcgatcgtggtattgcatta
cacaaaatgattaggcttattactatgggccttggtggtgaagggtatttaaattttatg
gggaatgaattcggccatcctgagtggatcgattttccaaggggtgatcaacatcttcct
aatggcacagtagttcctgggaataacaacagttatgataaatgcaggcgtagatttgac
ttgggtgatgcagaatatctaagatatcatggaatgcaagaatttgatcgagctatgcag
cacctagaagaaagatatggtttcatgatttctgagcaccaatatatttcaaggaaaaat
gaaggtgacagagttataatctttgaaagggacaacctggtctttgtattcaattttcac
tggaccaacagttattcagattacaaagttggctgtttaaagccagggaaatataagatt
gtcttggattcagatgagtccttgtttggtggcttcaataggctcaatcatactgctgag
tacttcacttcggaaggatggtatgatgaccggcctcgttccttcctcgtttatgcacct
tgtagaacagcagtggtatatgctcttgtagatggagttgaatcagagccggttgaactg
tcagttggagttgaatcagagacaattcaacaatcagttgaagttgaaccctga

DBGET integrated database retrieval system