KEGG   Medicago truncatula (barrel medic): MTR_7g112870Help
Entry
MTR_7g112870      CDS       T01716                                 

Definition
Serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:mtr03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 339 aa AA seqDB search
MEGEMDKTVVDDVIRRLLEGKGGKQVQLSESEIRQLCINARQIFLSQPILLDLRAPIRIC
GDIHGQYQDLLRLFEYGGYPPAANYLFLGDYVDRGKQSLETICLLLAYKIRYPDRVYLLR
GNHEDAKINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDEKILCMHGGLSPELQN
LDQIREVTRPTEIPDSGLLCDLLWSDPDPKAEGWADSDRGVSCTFGSDVVAEFLDKNDLD
LICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDESLVCSFEILKPADKE
FGSSSSKMNLKKVNFNNQWSQFPPCTGIDLVIVQVFRFK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagaaatggacaaaacagtggtagatgatgtgataagaagattgttagaagga
aagggaggaaaacaagtacaactttctgaatctgagattcgtcaactttgcatcaatgca
agacaaatcttcctctctcaacctattcttcttgatcttcgtgctcccatccgcatttgc
ggtgatattcatggtcaataccaagacttattgagactttttgaatatggtggctaccct
ccagctgcaaattacttgtttcttggtgattatgtagacagagggaagcaaagtttggag
actatatgcttgcttttggcctacaaaataagatatccggacagagtttatctcttaaga
ggaaaccatgaagatgcaaagataaaccgaatatatggtttttacgatgaatgtaaaagg
aggttcaatgttaggctatggaagatattcactgattgctttaactgtttgccggtagct
gcactcattgatgagaaaatactttgtatgcatggaggactttctcctgaattacaaaat
ttagatcagataagagaggttacgaggcctaccgaaattccagacagcggtctcttgtgt
gatctgctttggtctgatcctgatcctaaagctgagggttgggcagatagcgaccgaggt
gtttcgtgtacttttggatctgatgttgtcgcggagtttttggataaaaatgatcttgat
cttatttgcaggggtcatcaggttgtggaggatggatatgagtttttcgctaaaagaaga
ttagttacaatattctctgccccaaattatggtggggaatttgacaacgccggtgcgtta
ttgagcgttgatgaatctcttgtatgttcgtttgagatactgaaacctgctgataaagaa
tttggaagtagttcatcaaaaatgaatttgaagaaggtaaatttcaacaatcaatggtcg
caatttcccccctgcactgggatagatctagtcattgtgcaagtatttcgattcaaatag

DBGET integrated database retrieval system