KEGG   Medicago truncatula (barrel medic): MTR_8g023310Help
Entry
MTR_8g023310      CDS       T01716                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MTR_8g023310
   00500 Starch and sucrose metabolism
    MTR_8g023310
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MTR_8g023310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 589 aa AA seqDB search
MNKIKQSLAGISNSGNKKKLLISLFTTLLIVASIVAIVATTTKNSNKSKNNSIASSSLSL
SHHSHAILKSACTTTLYPELCFSAISSEPNITHKITNHKDVISLSLNITTRAVEHNYFTV
EKLLLRKSLTKREKIALHDCLETIDETLDELKEAQNDLVLYPSKKTLYQHADDLKTLISS
AITNQVTCLDGFSHDDADKEVRKVLQEGQIHVEHMCSNALAMTKNMTDKDIAEFEQTNMV
LGSNKNRKLLEEENGVGWPEWISAGDRRLLQGSTVKADVVVAADGSGNFKTVSEAVAAAP
LKSSKRYVIKIKAGVYKENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSATVA
IVGGNFLARDITFQNTAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFFVNC
FISGTVDFIFGNSAVVFQNCDIHARRPNSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATK
DLEGVKGNFPTYLGRPWKEYSRTVFMQSSISDVIDPVGWHEWNGNFALNTLVYREYQNTG
PGAGTSKRVTWKGFKVITSAAEAQSFTPGNFIGGSSWLGSTGFPFSLGL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaataaaacaatccctcgccggaatctcgaattccggcaacaagaaaaaactc
ctcatctccctctttacaacccttctcattgtagcttccatagtagccattgttgcaaca
acaaccaaaaactccaacaaaagcaaaaacaacagcattgcttcatcttctctttcactc
tctcaccattctcacgccatactcaaatccgcttgcaccaccactctctaccctgaacta
tgtttctcagccatttcctccgaaccaaacataactcataaaatcaccaaccacaaagat
gtgatttcattgtctctaaacatcacaactagagcagttgaacataattacttcaccgtc
gaaaaacttcttttgcgaaaaagtcttactaaaagagagaaaattgctcttcatgattgt
ttggaaaccattgatgaaacactagatgagctcaaagaagcacaaaatgatcttgtacta
tacccgagtaaaaagacactttatcaacatgctgatgatcttaaaacactcataagttcc
gccataaccaatcaggtaacttgtttggatggattctctcacgacgacgccgataaggaa
gtgaggaaggtcctacaagaaggccaaattcacgtggagcacatgtgtagtaatgcatta
gccatgactaagaacatgacagacaaagacatagcggaatttgaacaaaccaatatggtg
ttgggaagtaacaaaaatagaaaattattggaggaggaaaatggggtgggttggccggag
tggatatcggccggggacagaagattacttcaaggatcgaccgtaaaggcggacgtggtg
gtggcggcagacggtagtgggaactttaagacagtgtctgaggctgtggctgctgctcct
ttgaagagtagcaagagatatgttattaagataaaagctggggtgtataaagaaaatgtg
gaggtgccaaagaagaaaactaatataatgtttttgggagatggtagaactaatactatt
attactggtagtagaaatgttgttgatggaagcaccacttttcattcagccaccgtcgcc
atagtgggaggaaactttttagcacgagatataactttccaaaacacagcaggacccgca
aagcaccaagcagtggccctaagagttggtgctgacctatcagcattctacaattgtgac
atcatagcataccaagacacactatatgttcacaacaatagacaattctttgtaaattgt
ttcatttcaggaacagttgatttcatctttggtaattcagctgttgtgttccaaaattgt
gacatacatgctagaagacctaattcaggacaaaaaaatatggtcacagcacaaggtagg
gttgatcctaatcaaaacactggaattgtgatacaaaaatgtagaattggtgcaactaaa
gatttggagggtgtgaagggaaattttcctacatatcttggtagaccttggaaggaatat
tcaagaacagttttcatgcaaagtagtattagtgatgttattgatcctgttggatggcat
gagtggaatggtaactttgcattgaatactttggtttatagggaatatcaaaatactggt
cctggtgctggaacttctaagagggttacttggaaagggtttaaggtcattactagtgct
gctgaggcacaaagttttactcctggaaattttattggtgggtctagttggttgggttca
actgggtttcctttctctcttgggttgtaa

DBGET integrated database retrieval system