KEGG   Medicago truncatula (barrel medic): MTR_8g039160Help
Entry
MTR_8g039160      CDS       T01716                                 

Definition
Beta Galactosidase-like protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MTR_8g039160
  Lipid metabolism
   00600 Sphingolipid metabolism
    MTR_8g039160
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MTR_8g039160
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MTR_8g039160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1118 aa AA seqDB search
MASSPSSSLVGPLLLAPNNGYKVWEDPSFIKWRKRDPHVHLHCHESVEGSLKYWYQRSKV
DYLVSQSAVWKDDAVNGALESAAFWVKDLPFVKSLSGYWKFFLASNPCNVPAKFHDSEFQ
DSEWSTLPVPSNWQLHGFDRPIYTNVTYPFPLDPPFVPTENPTGCYRMDFHLPKEWEGRR
ILLHFEAVDSAFCAWINGHPIGYSQDSRLPAEFEVTDFCHPCGSDLKNVLAVQVFRWSDG
CYLEDQDHWRMSGIHRDVLLLAKPEVFITDYFFKSNLAEDFSSAEMLVEVKIDRLQDTSI
DNVLTNYTIEATLYDSGSWESSDGNPDLLSSNVADITFQPTTTPLGFYGYTLVGKLQSPK
LWSAEQPYLYTLVVVLKDKSGRVLDCESSQVGFKNVSKAHKQLLVNGHPVVIRGVNRHEH
HPEVGKANIESCMVKDLVLMKQNNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIETHG
FDYSKHLKHPTLEPMWATAMLDRVIGMVERDKNHTCIISWSLGNESGFGTNHFAMAGWIR
GRDSSRVIHYEGGGSRTPCTDIVCPMYMRVWDMLKIANDPTETRPLILCEYSHAMGNSNG
NLHIYWEAIDNTFGLQGGFIWDWVDQALRKVQADGTKQWAYGGEFGDIPNDLNFCLNGLV
WPDRTAHPVLHEVKFLYQPIKVNLSDGKLEIKNTHFFQTTEGLEFSWYISADGYKLGSDK
LSLPPIKPQSNYVFDWKSGPWYSLWDSSSSEEIFLTITAKLLNSTRWVEAGHVVTTAQVQ
LPAKRDIVPHAINIGSGNLVVETLGDTIKVSQQDVWDITFNTKTGLIESWKVKGVHVMNK
GIHPCFWRASIDNDKGGGADSYLSRWKAAGIDSVHFIAESCSVQSTTGNAVKLLVVFHGV
TKGEEGSLPNQDKSKVLFTTEMTYTIYASGDVILECNVKPNADLPPLPRVGIEMNLEKSL
DQVSWYGRGPFECYPDRKAAAQVAVYEKSVDELHVPYIVPGESGGRADVRWATFLNKNGF
GIYTSKYGSSPPMQMSASYYSTSELDRAGHDYELVKGDNIEVHLDHKHMGLGGDDSWSPC
VHDQYLVPPVPYSFSVRLSPVTPATSGHDIYRSQLQNS
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaccttcttcttctttggttggtccacttcttcttgctccaaacaatggt
tataaggtttgggaagacccatccttcatcaaatggagaaaaagagacccacatgttcat
ttgcattgccatgaatctgttgaaggatctcttaaatattggtatcaacgaagcaaagtg
gattatctggtttctcaatctgctgtttggaaagatgatgctgttaatggagctcttgag
agtgctgctttttgggtcaaagacttgccttttgttaaatctttgtcagggtattggaaa
tttttcttggcttctaatccctgcaatgtccctgctaaatttcatgatagtgagtttcag
gattcagaatggagtactttacctgttccttcgaattggcagctgcatggatttgaccgt
cctatatatacaaatgtaacatatccatttccccttgatcctcctttcgttcctactgaa
aatccaactggctgctacagaatggacttccatcttcctaaagagtgggaaggtagaaga
attttgttacattttgaagcagttgattcagccttttgtgcatggataaacggccatccg
ataggatacagtcaagacagcaggctacctgcagagtttgaagtcactgatttttgtcat
ccatgtggttcagacctgaagaatgttctggcagttcaagtgttcagatggagtgacggg
tgttaccttgaggatcaagaccattggcgcatgtctggcatccaccgtgatgttcttctt
ctagcaaagccagaggtatttatcaccgactatttcttcaaatctaacctcgctgaagat
ttttcttccgcggagatgctggttgaagtaaaaatagatagattacaagatacatcaatt
gataatgttcttacaaactacaccatagaagctacactctatgattctggaagctgggaa
tcctctgatgggaatccggatctcctttcatctaatgtagccgacataacattccaacca
acaaccacacctttagggttttatggctatacgctcgtgggaaaactgcaatcaccaaag
ctttggtcagcagaacagccatacctctatacattagttgtcgtcctcaaagataaatct
ggccgtgtgctagactgtgaatcaagtcaagtaggatttaaaaatgtatccaaagcccac
aaacaactgcttgttaatggacatcccgttgtaataagaggtgtgaacaggcatgaacat
catccagaagtgggaaaggcaaacatagaatcctgcatggtcaaggacttggttttaatg
aagcaaaacaatatcaatgccgtgaggaacagccattatcctcaacatccacgttggtat
gagctatgtgatttgtttggcatgtacatgatagatgaagccaatattgaaacacatggt
tttgattattctaaacatctcaaacatcctactctggaaccaatgtgggcaactgcaatg
ttggatcgtgtgattggcatggttgagagggataaaaatcacacatgcattatttcctgg
tctctagggaatgaatctggattcggaacaaatcattttgctatggctggttggattcga
ggaagagattcttctcgggttatacattatgaaggaggtggatcaagaaccccatgcact
gatattgtttgccctatgtatatgcgtgtttgggacatgttgaaaattgccaatgatcct
accgaaacacgtcctctgatactgtgcgagtattcacatgcaatgggaaacagcaatgga
aacttgcatatatattgggaagcaattgacaacacatttggactccaaggaggctttata
tgggattgggttgatcaggctcttcggaaggttcaagcagatggtacaaagcaatgggca
tatggaggtgaatttggagatattccaaatgatttgaatttttgtttgaacggtcttgta
tggcctgatcgaactgctcatcctgttttacatgaagtgaagttcttataccaaccaatc
aaggtgaatttaagtgacggcaaattagagataaaaaacacccatttttttcaaaccact
gaagggttggagttcagctggtatatttcagcagatggatacaaactgggatctgataag
ttgagtcttcctccaataaagccgcagagcaattatgtctttgattggaaatcgggtcca
tggtattctctatgggattcatcatcatcggaggaaatatttttgacaattacggctaag
cttttgaactctacgcgctgggttgaagctggtcatgttgttactactgctcaagttcaa
ctgccagctaagagagacattgttcctcatgctatcaatattggtagtggcaatctagtc
gttgaaacacttggagatacaatcaaagtcagccagcaagatgtttgggacataacattc
aacactaaaacaggtttaattgaaagctggaaggtaaaaggagtacatgttatgaataag
ggcatacacccgtgtttctggcgagcttccattgacaatgataaaggaggaggagctgat
agttatttgtccaggtggaaagctgctggaattgatagtgtccactttattgctgagagc
tgttctgtgcagagtacgacaggaaatgcggttaaactgttggtggttttccatggtgtt
accaagggcgaggagggttctcttccaaaccaggacaaatcaaaggttttatttacaaca
gaaatgacatacacaatttatgcttctggggatgtcattttggaatgcaatgtgaaacca
aatgctgatcttcctcctttgcctcgcgtgggaattgagatgaacttggaaaaatcatta
gatcaagtaagttggtacggaagagggccgtttgagtgttatccagatagaaaggctgct
gcgcaggttgcggtctatgagaagagtgtagatgagttgcatgttccttatattgttccc
ggggaatctggtggtagggcagatgttagatgggcaacattcttgaacaaaaatggtttt
ggaatatatacttcaaaatatggtagttctccacccatgcaaatgagtgcaagctactat
agcacttcagaacttgaccgggccggacacgattatgagctggttaaaggagataacatt
gaggttcatctagaccacaagcacatgggtttgggtggagacgatagttggtctccatgt
gttcacgaccaatatttggttcctccggtgccgtattccttctctgtcaggttgtctccg
gtaactccggctacttctggtcatgacatctacagatcacagcttcaaaactcttga

DBGET integrated database retrieval system