KEGG   Medicago truncatula (barrel medic): MTR_8g044160Help
Entry
MTR_8g044160      CDS       T01716                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mtr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 288 aa AA seqDB search
MTLSFPAFFKSLPFAQNLEPEILNGAIALVAVGLTAAYIYYRKNPKGSLDPKNFKEFKLV
KKTMISPNSARFKFALPTPNSILGLPVGKNILVRGRDSQGEEVMRSYTPITLDSDIGYFE
LVVKMYPNGKMSHHFRQMKEGDNLAVKGPKGRFSYKPGQVRAFGMIAGGSGITPMFQVIR
AILENPKDKTKVYLIYANVTVDDILLKEELDRFADKFPHRFHVFHVLNKPPNQWNGGTGY
ISKEMIESHCPAPAPDIQILRCGPPPMNKAIATHLAALGYTSNMQFEF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacacttagcttccctgcatttttcaagtccttaccttttgctcaaaacttggagcct
gaaattctaaatggtgcaattgctcttgttgctgtaggcctaacagctgcttatatttac
tatcgcaaaaaccccaaaggtagcttggaccccaaaaatttcaaagaatttaaacttgta
aagaagaccatgatcagccccaattctgcaagattcaaatttgcccttcctactcctaat
tcgatattgggacttcctgttggaaaaaacatacttgtcagaggaagagatagtcaagga
gaagaagttatgagatcatatactccaatcacattggattcagatattggctattttgaa
ttagttgtgaagatgtatccaaatggaaaaatgtctcaccattttagacaaatgaaggaa
ggtgacaacttggccgtgaagggccccaagggacgtttcagttacaaacctggccaagtt
agggcatttggaatgattgctggaggttcaggcattaccccaatgtttcaggtcataaga
gccatactggaaaacccaaaggacaaaacaaaggtgtaccttatttatgccaatgtgaca
gtggacgatatcctactaaaggaagaactagatcgctttgcagacaaatttcctcacaga
ttccatgtctttcacgttcttaataagcctcctaatcaatggaatggaggtactgggtac
atatcaaaggagatgattgaatctcattgtccagcacctgcccctgatatccagatactt
agatgtggtccaccacccatgaataaagccatagcaactcatcttgcagcacttggatac
acatcaaacatgcagtttgagttctaa

DBGET integrated database retrieval system