KEGG   Medicago truncatula (barrel medic): MTR_8g062330Help
Entry
MTR_8g062330      CDS       T01716                                 

Definition
Histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MTR_8g062330
Transcription machinery [BR:mtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MTR_8g062330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 447 aa AA seqDB search
MEPQTGPSAFATSSIHKRKHLSEDHSPPFHPSCDSSMHNFTGSVNSLATTSGSVPDFVVK
DEAATNIFTENLQIRGGYSAREESLKKEEESGLLKFVCVCNDGVDDHMVSLIALKNIFAR
QLPNMPKEYIVRLIMDRNHKSIMVIREPNRVVGGVTYRPYANQRFAEIAFCAISDDRQVK
GYGTRLMNHLKQYARDVDGLTHFLTYADNNAIGYFIKQGFTKEIHLEKDRWEGYIKDYDG
GTLMECKLDPKIPYTDLTTMIRRQRQALFEKIRELSNCHNIVYAGIDFQKRSEDGVIPNR
IVDDIPGLKEAKWTPDMYGHSRFRALDGSTDHATNLKHLTEFMRSILKEMHDHPDAWPFK
EPVDALSVPGYYEIIKNPMDLKTMSERLESEQYYVTFEMFLADARRMFENARTYNPPKTI
YYKCATRLEAHFQSKVTTLLQSGFKIQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcagactggcccttcggccttcgccacttcttccatccacaagcgcaaacac
ctgtccgaggatcactcgcctccattccacccttcttgcgactcttcgatgcacaacttc
accggttctgtcaacagtttggccactacttccggttctgtccccgactttgtggttaag
gacgaagccgcaacaaatatattcactgaaaacttgcagataagaggtggttacagtgcc
agggaagagagtcttaagaaagaggaagaatctggattactcaaatttgtatgcgtgtgc
aatgatggtgttgatgaccatatggtttcgttgatagcattaaagaatatatttgccaga
caacttcccaatatgccaaaggagtacattgtccgacttattatggataggaaccataag
tctataatggttataagggagcctaatcgcgttgttggaggcgttacatatcgtccatat
gcaaatcagaggttcgctgagatagccttttgtgcaattagtgatgatcgacaagtaaaa
ggttatggtaccagattgatgaatcacttgaaacagtatgcacgtgatgtagatggactg
acacattttctcacgtatgctgataataatgctattggctatttcatcaaacaaggtttt
acaaaagagattcacttggagaaagatcgatgggaaggttatataaaggattatgatggg
ggaactctcatggaatgtaagcttgatccaaagattccttatactgatttaacaactatg
atccgtcggcaaagacaggcactatttgaaaagattagagaactatcaaactgtcacaat
attgtttatgctggaattgattttcagaagagatcagaagatggagttattcctaataga
attgttgatgacatccctggtttgaaagaggctaaatggactcctgatatgtacggtcac
tcgcggtttagagctttagatggttctactgaccatgctacaaacctaaaacatttaact
gagtttatgcggtcaattctaaaggaaatgcatgatcaccctgatgcttggccatttaag
gagcctgttgatgcactgagtgttcctggttattatgaaatcatcaagaatccgatggat
ctaaagacaatgagtgagaggctggagtcagaacaatattacgtcacatttgagatgttt
ctcgcggatgccagaagaatgtttgagaatgcacgaacctataatcctccaaaaaccata
tattacaaatgtgctacaagactagaagcacactttcaaagcaaagtgacaacactccta
cagtctggcttcaaaattcagtag

DBGET integrated database retrieval system