KEGG   Medicago truncatula (barrel medic): MTR_8g067060Help
Entry
MTR_8g067060      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mtr  Medicago truncatula (barrel medic)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 737 aa AA seqDB search
MGPISDFPLMFIPPAMPSSPSSPELVHSEPNPNPIPEPEPNPESNTSHNAPSSPPQTTTN
KPPPTAAEIAARYILQSPPLSFAPKPLSTSEVTAAFGVIDDLPSLTDEEQKPLSSILTTS
SGDQFSGTSWWSNQLETGISALADLADLANPSDDDFGYQGYSIHTNLASYNSRKPFEIDN
GGWSPVDYGYNFNNFFATASSPRSPSLKSVGAGITNMGNTCFMSAILQCFTHTVQMFLGL
RYCTHASSCDVEGFCVICAFRDHLDDALERSRSPIVPRELVKNLNYFSAGFVIGNQEDAH
EFMQYALNKLKRGFPVGEENLIDQIFGGRLVSKLRCCCCGHSSDKFEPLIDMSLEIEHVS
TIQQALESFTKVEKMDGKFICSDCNQEVTMEKQLMLDKAPSVAAFHLKRFLKDGDSVKKI
DKYVDFSKELDLKPYTCGSSSGDNVLLKYELYAVVEHRGPSPNSGHYFSFVRSAPDKWYL
MDDDKVSSVSEEEVLNRKAYILFYAQQGTPWFSSIVENEETAPKSKYLHNKYGFDCDNNG
EKDDNDSTDANYDNCVSDMDEECDSGIYGHLSWKGLKIMMKKKMVRDLPKLQEIEAKCKD
RLLGKQHRESIPKKTQWRASEKLDLVHSDLCGLIKPSSNSGSRYFMTFTDDFSRKTWIYI
LKEKSRALEVFKQFKSLVEKESSYQTKSEGNLLHLTHLNKMVLRTERKNRTLKNMVRSML
RSKLTCKNKVLFQLSYL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggaccaatttcagatttcccattaatgttcattccaccagctatgccttcttcacct
tcttctcctgaactcgttcactccgaacctaatcccaatcccattcccgaacctgagcct
aatcccgaatctaatacctctcacaatgctccatcttctcctccacaaaccaccacaaac
aaaccaccaccaaccgccgcagaaatcgcggcgcgatatattctacaatccccgccgtta
tcttttgcgccaaaaccactgtctacgtcggaagttacggcggcgttcggcgttatcgac
gatcttccatcgttaaccgatgaagaacagaagccactgagttcgatcttaactacttcc
tccggtgatcagttttctggaacctcttggtggagtaatcagttggaaactggtatctct
gctcttgctgatcttgctgatcttgctaatccttctgatgatgattttggttatcaaggt
tactcgattcacacaaatcttgcttcgtataatagccgtaaacctttcgaaatcgataat
ggcggttggtctcccgttgactacggttataatttcaacaatttctttgccaccgcgtcg
tcgcctaggtcgccttcgttgaaatcggtgggagctggaattacgaatatgggaaacaca
tgttttatgagtgcaattcttcagtgttttacacatacagtgcaaatgtttcttggtctt
cgttattgcactcatgcatcttcatgtgatgtggaaggtttctgtgttatttgtgctttc
cgggatcaccttgacgatgctttggaacgttctagatctccaattgttccaagagagctt
gttaaaaatttgaactatttttcagctggttttgtaataggtaaccaggaggatgcacat
gagtttatgcaatatgctttgaataaactgaaaagaggcttcccagttggagaagaaaat
ctaattgatcaaatatttgggggtcgtcttgttagcaaacttcgatgttgctgctgtggt
cactcttctgataaatttgagccattgatcgacatgagtttagagatagaacatgtgagt
accattcagcaggctctggaatctttcaccaaggtagaaaagatggatggaaagtttatt
tgtagtgactgcaaccaagaagtaactatggaaaaacagcttatgcttgataaagctcct
tcagttgcagcatttcatttgaaaaggtttctaaaagatggagactcagttaaaaaaatt
gataaatatgtcgatttctctaaggaactggacctgaagccttatacatgtggtagtagc
agtggtgacaatgtacttttgaagtatgagctatatgctgttgtcgagcataggggacct
tcacctaattcagggcactattttagctttgtgcgttctgctccagacaaatggtatttg
atggatgatgataaggtttctagtgtttctgaagaagaagtcctgaatcgtaaggcatac
attctgttttatgcccaacaaggtacaccctggttctctagtattgtggaaaatgaagag
acagctccaaaatcaaaatatttacacaacaaatatggttttgattgtgataataatgga
gaaaaggatgataatgactcaaccgatgcaaattatgataactgtgtgagtgacatggat
gaagaatgtgattccggaatatatggccatcttagctggaagggtttgaagattatgatg
aagaaaaaaatggtgagagatttaccaaaactacaagaaattgaggcaaaatgcaaagat
cgcttgttagggaagcaacatagagaatctattccaaagaaaacacaatggagagcttca
gagaagcttgatctggttcattctgatctatgtggccttattaaaccaagttccaactct
ggtagcagatacttcatgacatttactgatgattttagtagaaaaacatggatatatatt
ttgaaagagaaatcaagagcattagaggtattcaagcaattcaagagtttagttgaaaag
gaatctagttatcaaacgaaatcagaaggtaacttactgcatcttacacacctcaacaaa
atggtgttacgtactgaaagaaagaataggaccttgaagaacatggtgaggagtatgctc
agaagcaagctaacttgtaagaacaaagttctctttcagctcagttacttgtaa

DBGET integrated database retrieval system