KEGG   Medicago truncatula (barrel medic): MTR_8g069040Help
Entry
MTR_8g069040      CDS       T01716                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTR_8g069040
   01230 Biosynthesis of amino acids
    MTR_8g069040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_8g069040
   00030 Pentose phosphate pathway
    MTR_8g069040
   00051 Fructose and mannose metabolism
    MTR_8g069040
   00052 Galactose metabolism
    MTR_8g069040
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MTR_8g069040
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MTR_8g069040
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MTR_8g069040
Messenger RNA biogenesis [BR:mtr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MTR_8g069040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 529 aa AA seqDB search
MASISHAITTTTNPYFNLPHQTQTPSSILTLSHSNSRRVFKNVGVFAEHRNSSSTSIDFN
DPDWKFKFQQDFESRFRLPHITDIFPDSPPIPSTFCLRMRTPIGKDIPGHYTLDEEWNGY
INNNDRVLLKTINYSSPKSAGAECIDPDCTWVEQWVHRAGPREKIYYKPEDVKAAIVTCG
GLCPGLNDVIRQIVITLEIYGVKKIVGIPFGYRGFSDKELTEVPLSRKVVQNIHLSGGSL
LGVSRGGPGVSDIVDSLEDRGINMLFVLGGNGTHAGANAIHNECCKRRLKVSVIGVPKTI
DNDILLMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGIGVVKLMGRSSGFIAMQASLSSG
QVDICLIPEVPFNLHGPHGVLRHLQYLLEMKGSAVVCVAEGAGQNLLQNTNAKDASGNIV
FGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILCTVLGQNAVHGAFA
GYSGISVGICNTHYAYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPDFI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatctcccacgcgatcaccaccaccaccaacccctactttaaccttcctcac
caaactcaaaccccttcctctatactcacactctctcactccaactcccgtagagttttc
aagaatgttggtgtttttgctgaacatagaaattcttcttcaacttccattgatttcaat
gatcctgattggaaattcaagtttcagcaagattttgaatcacgttttcgtcttcctcat
attactgatatctttcccgattctcctcctataccttctaccttctgtctcagaatgaga
actccgattggtaaagatattccaggtcattatacattggatgaggagtggaatggatat
attaataacaatgatagagtgcttctcaagacaattaactattcatcgcctaaatctgct
ggtgctgagtgcattgatcccgattgtacttgggtagaacaatgggttcatcgagctggg
cctcgggaaaaaatatactataaaccagaagatgtaaaggcagcaattgtcacatgtgga
gggctctgccctggtcttaatgatgtcatcagacagattgtaatcacacttgaaatatat
ggtgtgaaaaagatagtggggattcctttcggttatcgaggattttcagacaaagaattg
acagaagttccgctgtcgagaaaagtggttcagaatattcatctatctggtggaagcttg
ttgggagtttcacgaggaggacctggagttagtgatatcgtggatagtttggaggacaga
gggatcaacatgctttttgtattgggtggaaatggcacacatgctggtgcaaatgcaatt
cacaatgagtgctgcaaaagacggctcaaggtgtctgtcattggagtgccgaaaactatt
gataatgatattctattgatggataaaacatttggctttgatactgcagtggaagaagct
caaagagcaataaattctgcatacattgaggcacatagtgcatatcatggaattggggtt
gtgaagttgatgggccgtagtagtgggttcatagcaatgcaagcttccctatctagtgga
caggttgacatatgtctgattcccgaggtacctttcaatttacatggccctcatggtgtt
ttgaggcatcttcagtaccttctagaaatgaagggatccgccgtagtctgtgtggcagaa
ggagctggacagaacttgcttcaaaacaccaatgctaaagatgcatcgggaaatattgta
tttggagatatcggtgtatatattcaacaagagacaaaaaagtatttcaaggagattggt
gttcatgctgatgtaaaatatatcgatccaacatatatgatccgtgcatgtcgagcaaat
gcatcagatggaattttatgcactgtacttggacaaaatgctgttcatggtgcatttgca
ggatacagtggcatttcagtaggtatatgtaacactcactacgcttacttccccatcccc
gaagtaatatcacatccccgattggtggaccctaacagccgtatgtggcatcgttgctta
acttcaaccggccaacctgacttcatctga

DBGET integrated database retrieval system