KEGG   Medicago truncatula (barrel medic): MTR_8g086000Help
Entry
MTR_8g086000      CDS       T01716                                 

Definition
Mitogen activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MTR_8g086000
Protein kinases [BR:mtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MTR_8g086000
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MTR_8g086000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 421 aa AA seqDB search
MAINTKRGDVVNHSLPNQKNTTVTELLLEATSPEGFLVFGFGKMATLVEPPYRIKPKGKH
YYRISKTLFEVDMKYVPIKAIGRGTYGVVCSSINKDTDEKVAIKKISNIFDNCIDSVRTL
REMMLLRNIRHENVIALKDVMMPVHRTSFKDVYLVYELMETDLHQIIKSTQPLSNDHCKY
FLFQVLISLSYTFSLLRGLNYIHSAKILHRDLKPSNLLVNSNCDLKICDFGLARTNGVYG
EFMTEYVVTRWYRAPELLLSCDSYGTSIDVWSVGCILAEILGRKPIFPGTSSLDQLKLIV
SVLGSPHEYDLEFIDTQRERMFIKSFPYTRGVHFSNLFPQADPLAIDLLQKMLVFDPTRR
ITVSEALQHPYMADLYDPWCNTPAEVPINLDIDENWGEQMIREMMWNEMLHHHPEVAYAN
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctataaataccaagagaggggatgtggtgaatcactctctaccaaaccaaaagaac
actactgtgacagagcttttacttgaagctacatcacctgagggattcttggtctttgga
tttggaaaaatggcaacgttagttgaacccccttacagaattaagccaaagggaaagcat
tattatagaatatcaaaaacattgtttgaggttgatatgaagtatgttccaattaaggct
attggcagaggaacatatggtgtggtgtgctcatccatcaataaagatactgatgagaaa
gttgcaattaagaagattagcaatatatttgataattgtattgattcagtgagaacttta
agggagatgatgctgcttagaaatattcgacacgagaatgtgattgctttgaaagatgtt
atgatgccggtacatagaacaagttttaaggatgtctacttggtttatgaactcatggaa
acagatcttcatcaaattatcaagtctactcagccactttctaatgatcattgcaaatat
ttcttgtttcaggtactaattagcctgtcatacacattctctctactacgtggtcttaat
tatattcactctgcaaagattcttcaccgagatttgaagcctagtaatctgcttgtcaat
agcaattgtgatttgaagatatgtgactttgggcttgcccgaaccaatggagtgtatggc
gagtttatgacggagtatgttgtcacacgctggtatcgtgctcccgagcttctattaagt
tgtgacagttacggaacctccatcgatgtgtggtccgtaggatgcattcttgctgagatt
cttggtagaaagccaatcttccctggaactagtagtttggatcaactgaaactaattgta
agtgttcttgggagtccgcatgaatatgatctcgagttcattgatactcaaagagagagg
atgtttatcaaatcatttccttatacacgaggggtacacttctctaatctattcccacaa
gcggatccattagccatagacttgttacaaaaaatgcttgtgttcgatccgacgagaaga
attactgtctcagaagcacttcaacatccatatatggctgatctatatgatccatggtgt
aatactcctgctgaagtccctataaatctcgacattgatgaaaattggggcgaacaaatg
attagagaaatgatgtggaatgagatgctacatcaccatcctgaagttgcttatgccaat
gcataa

DBGET integrated database retrieval system