KEGG   Medicago truncatula (barrel medic): MTR_8g092350Help
Entry
MTR_8g092350      CDS       T01716                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_8g092350
Peptidases [BR:mtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MTR_8g092350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 370 aa AA seqDB search
MKTGISNKFENFDCLPLSPVLSNRYAICCMPTGTLINKFDWLQRVGCTLEECLKQFIVAE
HIENYNCSHCWHNAAIKYLSLMEGDKVELGNLGRCSDQEFCDCQKTYNLENLPWSNRFSH
ALKQLSIARCPRILCIQLKRVHMNDFGESFKLQGHISFPLILDVSSFMTTRLGVKIQEED
VVKIQEEDVQSRSNSLPNHSNMHSGIIRMIKSGVLYGGAREQIDADARIEIVSSSTSRQA
ILINFPCSGSSESIQSNTQSQSIDTNMSLPMEIGMEPGNGMGWVDDRIDSQDTCLYQLVS
VVEHFGRAGGGHYTVYRCVRPESSDVSGDCINQNSMRWFGVSDSHVDAVSVEEVLSAEAS
LLFYERIPNN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagggatctcaaataaatttgaaaattttgattgtttgcctctttcacctgtg
cttagtaatagatacgctatatgctgcatgcctactggaactctgattaataaatttgac
tggttgcagagagttggttgtaccctggaggaatgcctgaagcagttcattgtagctgaa
cacattgaaaactacaactgcagccactgttggcataatgctgcaatcaagtatctttcc
ttgatggaaggagacaaggtagaacttggaaaccttgggagatgttctgaccaagagttc
tgtgattgccaaaaaacttataatcttgaaaatctaccgtggtcaaataggttttcacat
gctttgaagcagctaagtattgctcgctgtccaaggattttatgcatccagctgaaaaga
gttcacatgaatgattttggagagtcattcaaattacagggccatatatcttttccattg
attttggatgtgtcctcattcatgacaactagactaggagtgaagatacaggaagaagat
gtagtgaagatacaggaagaagatgtacaaagtagatctaactctttgccaaaccatagc
aatatgcattctgggataataaggatgattaaatctggtgtcctttatggaggagctaga
gagcagatcgatgcagatgctcgtattgaaatagttagctcgtccactagtagacaggca
attcttattaactttccttgttctggttcttcagaaagcattcagtcaaacacacagtcg
caatccattgacacgaatatgtctttgccaatggagatagggatggagccggggaacgga
atgggatgggttgacgacagaatagattctcaagatacatgtttgtatcaacttgtttct
gttgtggaacactttggaagagctggaggaggacattacactgtctacagatgtgtgaga
ccagagtcctcagatgtctcgggtgattgcatcaatcaaaattcaatgcgctggtttggt
gtttcagattctcacgtggatgctgtttcggtcgaagaagttctgtctgctgaggccagc
ttgcttttctacgagagaattccaaataactga

DBGET integrated database retrieval system