KEGG   Medicago truncatula (barrel medic): MTR_8g098430Help
Entry
MTR_8g098430      CDS       T01716                                 

Definition
Glutathione S-transferase theta
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mtr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 251 aa AA seqDB search
MGKLKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILH
GNFNLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINSVLDWHHSNLRYGAVNYVSNTV
LGPALGRPLNPEAAAEAEKVLLSSLSKLEDIWLNGDGHFLLGGFQPSIADLSLVCELTQL
EVLDEKDRDRILFPYKKVLQWIEDTRTATNPHFEEVHNILYRAKKKFQQQRSRVAKTGTE
TNNVMERHSKM
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggggaagctgaaggtgtatgcagatcgaatgtcccaaccatctcgagcagttcttata
ttctgcaggttcaatggaattgacttcgaggagattaaagttgacctttcaaaacgtcac
catctatctcctgaattcacagaagtaaaccctttgcacaaagttccagctattcttcat
ggaaacttcaatctcttcgagagccatgcaatccttgtctatctttcttctgcttttcct
ggagttgctgaccattggtatccaactgatgttttcaggagagtcaaaattaactcagta
ttggactggcatcactctaatttacgatatggagcagtgaactatgtatcaaatactgta
ttaggacccgcacttggtcgtccactgaatccagaagcagctgctgaagcagagaaagtt
ttattatcttcattatcaaaactagaggacatttggctcaatggagatggacacttcctt
cttggtggttttcaaccatctatagcggatctcagcctagtttgtgaactcacacaactt
gaggttttggatgagaaggatcgcgatcgaattttgttcccatacaagaaagttcttcag
tggattgaggatacaagaactgcaacaaatccccactttgaagaagtgcataatatcctt
tatagagctaaaaagaaatttcaacagcagcgttcaagggtagctaaaactgggactgag
actaacaacgtgatggagaggcattccaaaatgtga

DBGET integrated database retrieval system