KEGG   Medicago truncatula (barrel medic): MTR_8g098430Help
Entry
MTR_8g098430      CDS       T01716                                 

Definition
(RefSeq) glutathione S-transferase, amino-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MTR_8g098430
Enzymes [BR:mtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MTR_8g098430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 252 aa AA seqDB search
MMGKLKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAIL
HGNFNLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINSVLDWHHSNLRYGAVNYVSNT
VLGPALGRPLNPEAAAEAEKVLLSSLSKLEDIWLNGDGHFLLGGFQPSIADLSLVCELTQ
LEVLDEKDRDRILFPYKKVLQWIEDTRTATNPHFEEVHNILYRAKKKFQQQRSRVAKTGT
ETNNVMERHSKM
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatggggaagctgaaggtgtatgcagatcgaatgtcccaaccatctcgagcagttctt
atattctgcaggttcaatggaattgacttcgaggagattaaagttgacctttcaaaacgt
caccatctatctcctgaattcacagaagtaaaccctttgcacaaagttccagctattctt
catggaaacttcaatctcttcgagagccatgcaatccttgtctatctttcttctgctttt
cctggagttgctgaccattggtatccaactgatgttttcaggagagtcaaaattaactca
gtattggactggcatcactctaatttacgatatggagcagtgaactatgtatcaaatact
gtattaggacccgcacttggtcgtccactgaatccagaagcagctgctgaagcagagaaa
gttttattatcttcattatcaaaactagaggacatttggctcaatggagatggacacttc
cttcttggtggttttcaaccatctatagcggatctcagcctagtttgtgaactcacacaa
cttgaggttttggatgagaaggatcgcgatcgaattttgttcccatacaagaaagttctt
cagtggattgaggatacaagaactgcaacaaatccccactttgaagaagtgcataatatc
ctttatagagctaaaaagaaatttcaacagcagcgttcaagggtagctaaaactgggact
gagactaacaacgtgatggagaggcattccaaaatgtga

DBGET integrated database retrieval system