KEGG   Medicago truncatula (barrel medic): MTR_8g102330Help
Entry
MTR_8g102330      CDS       T01716                                 

Definition
Profilin
Orthology
K05759  
profilin
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Exosome [BR:mtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MTR_8g102330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 131 aa AA seqDB search
MSWQTYVDDHLLCDIEGNHLTHAAILGVDGSVWAQSANFPQFKPEEINAINKDFDEPGTL
APTGLHIGGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaaacttatgttgatgatcaccttctctgtgacattgaaggtaatcatctc
actcatgctgctatcctcggtgtagacggtagcgtttgggctcagagtgctaatttccct
cagttcaagcctgaggagataaatgctatcaataaagacttcgatgagcctggaactctt
gctccaactggattacatattggtggtactaaatatatggtgattcaaggtgaacctgga
gctgtcattcgagggaagaagggtgctggtggtgttactgttaagaagaccaatatggcc
ttggtcattggcatttatgatgaaccaatgactcccggtcagtgcaacatggtagttgaa
aggcttggtgattatcttgttgaacagggtctttaa

DBGET integrated database retrieval system