KEGG   Medicago truncatula (barrel medic): MTR_8g104310Help
Entry
MTR_8g104310      CDS       T01716                                 

Definition
AMSH-like protease
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MTR_8g104310
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MTR_8g104310
Peptidases [BR:mtr01002]
 Metallo Peptidases
  Family M67
   MTR_8g104310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 511 aa AA seqDB search
MMTCSSDTISIAARTQKVDVDNRFSLRIYYRIADNILKQADIFRAEKNIIDLYIMLLRYS
SLVSETIPRHRDYRTSPQSKKELLRKKLLTSVIELEKLKPLAQQKINELNSRKSYQHSGR
DTFRSNYSTGFSPVKKQTMASYDEIKAVRQTAGEFVYRGSKAQQYPCVRPVEDSMKRLSL
TLPPPKEETLSRHSILGPNGLKGPWQPPTSDKGVRYPTIIDLSPVEIPSLHQSLEDGSQN
KKDNSISEHNKLDVESTLTQSEDCQVKHADETPSLISFEETEDFAPIKVIRQPSPPPVLA
EVQDLVPTVSPHVDEAGCKTETPLSDSFGRAESPLQLHISTAMMGSFMKLAKSNTDKNLE
TCGILAGSLKNRKFYITALIIPKQEATSSSCQATNEEEIFEAQDKRSLFPLGWIHTHPTQ
SCFMSSIDVHTHYSYQIMLPEAVAIVMAPTDSSRTHGIFRLTTPGGMSVIRQCQQRGFHP
HDPPPDGGPIYDTCTDVYLNPDLKFDVIDLR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgtgttcttcggatacgatcagcatcgctgcgagaactcagaaagtcgatgtt
gataatcgattttcgcttcgtatctactacaggatcgccgataatatcctcaaacaggct
gatatctttcgtgcagagaaaaatattattgatctatatatcatgctcctaagatattct
agtttggtctctgagacaataccacggcaccgagattatagaacatctccacagagcaag
aaagagttattgagaaagaaattgttaacttctgtgattgaactggagaagctgaaacca
ctggcacaacagaagatcaatgagcttaacagcaggaaatcatatcaacacagcgggagg
gacacgtttcgttcaaattattcgactggtttttccccggtgaaaaagcaaactatggct
agttacgatgaaataaaggcagtcagacaaactgctggagagtttgtctaccgaggatca
aaagcccagcagtatccttgtgtaaggcctgtggaagatagtatgaaaagactatctcta
actctccctcccccaaaggaagaaactctctccagacattctattctaggtccaaatggc
cttaaagggccgtggcaaccacctacaagtgataaaggggtgaggtatccaactatcata
gatctgtctccagttgaaattccaagccttcatcaatccttggaagatggatcacagaat
aaaaaagataatagcatttcagaacacaataaattagacgtagaatctactcttacccag
agtgaggactgccaggtcaaacatgctgatgaaactccttcgcttatctcttttgaagaa
acagaagactttgctcctataaaagttattagacagccttctcctccacctgtacttgct
gaagtacaagatttggttcctacagtatcacctcatgttgatgaggcaggatgtaagaca
gagactccattgtcagatagttttggccgtgctgagtctcctcttcaattacacatctca
actgcaatgatgggtagttttatgaagcttgccaagtctaacactgacaaaaatttagag
acttgtggtatccttgcaggctcgcttaaaaatagaaaattttatatcacagctctaata
atccccaagcaggaggcaacatcaagttcttgtcaagctacaaatgaagaggaaatattt
gaagcacaagataagcgatcactttttccccttggatggatccatacacaccctacacaa
tcttgtttcatgtcatcaattgatgtacacacccattactcatatcagattatgctgcca
gaagctgttgcaatagtcatggcaccaacagacagttcaagaactcatggtatttttcgg
ctgacaacccctgggggcatgtcggtcattagacaatgccagcaacgaggctttcatcca
catgatccgcctccagatggtggtcccatttacgatacatgtacagatgtttacttgaac
cccgatttaaaatttgatgtcattgatcttcgatga

DBGET integrated database retrieval system